SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000033932 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000033932
Domain Number 1 Region: 132-379
Classification Level Classification E-value
Superfamily vWA-like 7.56e-83
Family Integrin A (or I) domain 0.00000000529
Further Details:      
 
Domain Number 2 Region: 374-464
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-30
Family Integrin domains 0.0000151
Further Details:      
 
Domain Number 3 Region: 635-719
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.28e-24
Family Integrin beta tail domain 0.0000256
Further Details:      
 
Domain Number 4 Region: 24-82
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000235
Family Plexin repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 593-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Integrin beta EGF-like domains 0.00098
Further Details:      
 
Domain Number 6 Region: 551-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Integrin beta EGF-like domains 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000033932
Domain Number - Region: 520-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000033932   Gene: ENSTRUG00000013322   Transcript: ENSTRUT00000034058
Sequence length 791
Comment pep:known_by_projection scaffold:FUGU4:scaffold_81:942530:952442:1 gene:ENSTRUG00000013322 transcript:ENSTRUT00000034058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFNKISPLLIRVLTIRDASGSSNVCTTRGASTCKECLAVHPSCAWCLQEDFGLGVASS
PRCDLKRNLVAAGCTPSAVESPTSKLQVMEDRPLSNKATVATQDITQIKPQRLHINLRPD
DAKRFTVKVRQVEDYPVDLYYLMDLSYSMNDDLFRLRSLGKGLAEAMNRTTSNLRMGFGA
FVDKPLSPYMYISPKEAVKNPCYSINMTCLPQFGYKHVLTLTEEVSRFTEEVKKQMVSRN
RDAPEGGFDAIIQAAVCKKKIGWRPGASHLLIFTSDAKTHVALDGRLAGIVQPNDGKCHL
NAENMYSMSTTMDYPSLALITEKMSENNINLIFAVTNPVVPLYQNYSELIPGTTVGTLNN
DSGNVIQLILQAYAKIRSKVELELQGVPDGLSLSFNATCLNGELIPGLRSCSGLKIGDTV
SFTVEARARGCPKEKKKTFFIKPVGFKDTLSITVTFECDCKCQAKAQPSSPKCNHGNGTY
ECGICMCHPGRLGPHCECAEGDYDPTEQDSCSGPTGSGGRGSICSGRGDCVCGQCVCHSS
DFGKVWGKLCECDDFNCLHYKGELCSGHGVCNCGFCQCAPDWQGENCNCSRRTDTCMSSM
GLLCSGRGQCVCGACECTQPGAYGATCDKCPTCPDACTMKKECVECKHFKRGKLFQDNTC
SRICKDEIVLVDELGSGVTNAVNCSYKDEDDCVERFQYYEEASGKSILYVVKEPDCPKGA
DILVVLLSVAGAILFLGLAALLIWKLLITIHDRREFAKFEEERARAKWDTGHNPLYKEVT
STFTNITFRGK
Download sequence
Identical sequences H2UAG5
ENSTRUP00000033932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]