SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034251 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034251
Domain Number 1 Region: 24-117
Classification Level Classification E-value
Superfamily Immunoglobulin 2.85e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 110-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000693
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034251   Gene: ENSTRUG00000013432   Transcript: ENSTRUT00000034377
Sequence length 165
Comment pep:known_by_projection scaffold:FUGU4:scaffold_194:526289:527665:1 gene:ENSTRUG00000013432 transcript:ENSTRUT00000034377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSPGLLILCFLRSTAVVSRPQPGISVEPRAATVRQGESVSFRCQVGSDAAEPVEWKRT
NNQALQDNVKIGPGGSVLTITNARPGNQGQYRCTVQTAAGRKSATAALNVKFAPKVRLTP
AGPLRVRMGDPVSVECRAAGRPRPKMTWKRQGSTLQLVTKEANDA
Download sequence
Identical sequences H2UBD3
31033.ENSTRUP00000034251 ENSTRUP00000034251 ENSTRUP00000034251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]