SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035735 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035735
Domain Number 1 Region: 11-491
Classification Level Classification E-value
Superfamily Sema domain 5.62e-125
Family Sema domain 0.000000591
Further Details:      
 
Domain Number 2 Region: 1048-1314
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-75
Family Protein kinases, catalytic subunit 0.00000000547
Further Details:      
 
Domain Number 3 Region: 641-734
Classification Level Classification E-value
Superfamily E set domains 0.00000000000129
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 494-538
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000863
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 537-616
Classification Level Classification E-value
Superfamily E set domains 0.00000000322
Family Other IPT/TIG domains 0.074
Further Details:      
 
Domain Number 6 Region: 733-820
Classification Level Classification E-value
Superfamily E set domains 0.000000022
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035735   Gene: ENSTRUG00000013975   Transcript: ENSTRUT00000035863
Sequence length 1348
Comment pep:known_by_projection scaffold:FUGU4:scaffold_79:818771:828186:1 gene:ENSTRUG00000013975 transcript:ENSTRUT00000035863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSPVNFSVVYTMPFFQAGGPIQNIVNNSFYQEVYVASQNVIEAVNQSLEKVWELRTGPV
GSPECKICDLCNTDKDPSFLEDTNNEVLLLDTLFMYLYTCGSSQYGVCYFHQLNSTGEPP
SLSKCLYRKKSNSAAYCPDCVASSLGTKVTMVEEGQTVYFFVATTVNDSVTQRYGRKSLS
VRRPLATEDGFYSDVRGLTVLPSLRNTYHIEYVYSFFTQEFVFFLSVQRESPDQESSPFQ
TRLGRLPRNEWEMKRYREVILECRFEPKRRRRTVGSEPYKDVVYNVVQAAHFGKAGRELA
EELGAEEEDDILYGVFAVTDDNGVTEHDSALCAFPVDNVNKAIADGVDDCCQSGPEQLSR
GLCHFQPCESCPHEHVLCFKSTIMKQSMENNATCRDQPTMVSKPYYRVDLFNRQMTDVLL
TSLLVTTIENKTVAHIGTSTGRLLQLVLTRSSPIIFANYSLVENQRVSSIAAVYSSEYLL
FVVGDKMIQVPQRGPGCQHFLTCAVCLTAPKFVGCGWCSGVCSWESDCDHHWRNDSCPPG
ITGFFPRTAPPDGQTELTVFGWEFQSPLRPAITSRTHQVRLGQTACTVLPAKSNNSHLVC
KIRIGTMELFRPVNITVEVHEGKAEGRYSIDGKAEMSGFTFVIPNITEIQPNYGPRIGGT
LITVTGSHLDSGKTRKVTLNEVLCPIKRVTQPKGNVSSIICLSQHISEVRDVPLSVFIDK
SPILTTKVFYYKENPTITAVLPDCSFDRGSKIVIEGENLDSVYRTIVRFKPNESHLKPVT
RECVGNSSPTKMECFTPEFPRDETEEGELSFDMDGALGLWRFDEVSLHVSEPTEHQKLNL
VSSCMTIVMTMAGVNCDAKVLDNEITCRIPKNMSIPSEGLPVKTENTARSLDFDFQISIN
GQIHNVGTVVRVSNHYMVGIVLGILAALVAGAVLAFLVMKHLRKKKKGLKRVMKSFSAMM
IENRLSQTATRSGANNVEMMPVGDYRRGGCTSVGFPLTLVDPSSTGSIDPTLTPLIPPDK
ISISNFRPELLEEVKDVLIPAEMLVVQHHRIIGKGHFGTVYHGYFADCNSREIHCAVKSL
NRITDAEEVEQFLKEGIIMKGFHHCNVLSLLGILLPQEGLPLVVLPYMKHGDLRHFIRCD
KRNPTVKDLIGFGLQVATGMEYLAQKKFVHRDLAARNCMLDESYTVKVADFGMARDVLDK
EYYSVQNHRKAKLPVKWMAIESLQTQKFTSKSDVWSFGVLIWEMLTRGASPYPDVDPYDI
THYLLRGRRLPQPQFCPDPLYRIMLQCWDPDPELRPSFATLVSAVSVILSNLEGEHYISL
NVTYVNLDQPRPYPALTESADEYDSTDA
Download sequence
Identical sequences H2UFL5
ENSTRUP00000035735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]