SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035736 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035736
Domain Number 1 Region: 9-481
Classification Level Classification E-value
Superfamily Sema domain 4.32e-121
Family Sema domain 0.000000336
Further Details:      
 
Domain Number 2 Region: 1061-1327
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-75
Family Protein kinases, catalytic subunit 0.00000000547
Further Details:      
 
Domain Number 3 Region: 631-724
Classification Level Classification E-value
Superfamily E set domains 0.0000000000013
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 723-818
Classification Level Classification E-value
Superfamily E set domains 0.0000000000525
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 5 Region: 484-528
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000889
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 527-606
Classification Level Classification E-value
Superfamily E set domains 0.00000000322
Family Other IPT/TIG domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035736   Gene: ENSTRUG00000013975   Transcript: ENSTRUT00000035864
Sequence length 1361
Comment pep:known_by_projection scaffold:FUGU4:scaffold_79:818777:828186:1 gene:ENSTRUG00000013975 transcript:ENSTRUT00000035864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPVNFSVVYTMPFFQAGGPIQNIVNNSFYQEVYVASQNVIEAVNQSLEKVWELRTGPVGS
PECKICDLCNTDKDPSFLEDTNNEVLLLDTLFMYLYTCGSSQYGVCYFHQLNSTGEPPSL
SKCLYRKKSNSAAYCPDCVASSLGTKVTMVEEGQTVYFFVATTVNDSVTQRYGRKSLSVR
RPLATEDGFYSDVRGLTVLPSLRNTYHIEYVYSFFTQEFVFFLSVQRESPDQESSPFQTR
LGRLPRNEWEMKRYREVILECRFEPKRRRRTVGSEPYKDVVYNVVQAAHFGKAGRELAEE
LGAEEEDDILYGVFAVTDDNGVTEHDSALCAFPVDNVNKAIADVSVILFSVSCLTETQSH
SHRNHVLCFKSTIMKQSMENNATCRDQPTMVSKPYYRVDLFNRQMTDVLLTSLLVTTIEN
KTVAHIGTSTGRLLQLVLTRSSPIIFANYSLVENQRVSSIAAVYSSEYLLFVVGDKMIQV
PQRGPGCQHFLTCAVCLTAPKFVGCGWCSGVCSWESDCDHHWRNDSCPPGITGFFPRTAP
PDGQTELTVFGWEFQSPLRPAITSRTHQVRLGQTACTVLPAKSNNSHLVCKIRIGTMELF
RPVNITVEVHEGKAEGRYSIDGKAEMSGFTFVIPNITEIQPNYGPRIGGTLITVTGSHLD
SGKTRKVTLNEVLCPIKRVTQPKGNVSSIICLSQHISEVRDVPLSVFIDKSPILTTKVFY
YKENPTITAVLPDCSFDRGSKIVIEGENLDSVYRTIVRFKPNESHLKPVTRECVGNSSPT
KMECFTPEFPRDETEEGELSFDMDGALGLWNKEFSYHPYGQPIPFETEGHVLSLYPGFDE
VSLHHQKLNLVSSCMTIVMTMAGVNCDAKVLDNEITCRIPKNMSIPSEGLPVKDFDFQIS
INGQIHNVGTVVRVSNHYMVGIVLGILAALVAGAVLAFLVMKHLRKKKKARTSLSPLRTY
KCSSAELMIKKRMIENRLSQTATRSGANNVEMMPVGDYRRGGCTSVGFPLTLVDPSSTGS
IDPTLTPLIPPDKISISNFRPELLEEVKDVLIPAEMLVVQHHRIIGKGHFGTVYHGYFAD
CNSREIHCAVKSLNRITDAEEVEQFLKEGIIMKGFHHCNVLSLLGILLPQEGLPLVVLPY
MKHGDLRHFIRCDKRNPTVKDLIGFGLQVATGMEYLAQKKFVHRDLAARNCMLDESYTVK
VADFGMARDVLDKEYYSVQNHRKAKLPVKWMAIESLQTQKFTSKSDVWSFGVLIWEMLTR
GASPYPDVDPYDITHYLLRGRRLPQPQFCPDPLYRIMLQCWDPDPELRPSFATLVSAVSV
ILSNLEGEHYISLNVTYVNLDQPRPYPALTESADEYDSTDA
Download sequence
Identical sequences H2UFL6
ENSTRUP00000035736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]