SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035737 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035737
Domain Number 1 Region: 6-469
Classification Level Classification E-value
Superfamily Sema domain 2.75e-126
Family Sema domain 0.000000641
Further Details:      
 
Domain Number 2 Region: 1067-1356
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-71
Family Protein kinases, catalytic subunit 0.000000011
Further Details:      
 
Domain Number 3 Region: 658-750
Classification Level Classification E-value
Superfamily E set domains 0.00000000000154
Family Other IPT/TIG domains 0.065
Further Details:      
 
Domain Number 4 Region: 749-844
Classification Level Classification E-value
Superfamily E set domains 0.0000000000525
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 5 Region: 488-532
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000889
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 531-593
Classification Level Classification E-value
Superfamily E set domains 0.00000149
Family E-set domains of sugar-utilizing enzymes 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035737   Gene: ENSTRUG00000013975   Transcript: ENSTRUT00000035865
Sequence length 1370
Comment pep:known_by_projection scaffold:FUGU4:scaffold_79:818786:828126:1 gene:ENSTRUG00000013975 transcript:ENSTRUT00000035865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFSVVYTMPFFQAGGPIQNIVNNSFYQEVYVASQNVIEAVNQSLEKVWELRTGPVGSPEC
KICDLCNTDKDPSFLEDTNNEVLLLDTLFMYLYTCGSSQYGVCYFHQLNSTGEPPSLSKC
LYRKKSNSAAYCPDCVASSLGTKVTMVEEGQTVYFFVATTVNDSVTQRYGRKSLSVRRPL
ATEDGFYSDVRGLTVLPSLRNTYHIEYVYSFFTQEFVFFLSVQRESPDQESSPFQTRLGR
LPRNEWEMKRYREVILECRFEPKRRRRTVGSEPYKDVVYNVVQAAHFGKAGRELAEELGA
EEEDDILYGVFAVTDDNGVTEHDSALCAFPVDNVNKAIADGVDDCCQSGPEQLSRGLCHF
QPCESCPHESMENNATCRDQPTMVSKPYYRVDLFNRQMTDVLLTSLLVTTIENKTVAHIG
TSTGRLLQLVLTRSSPIIFANYSLVENQRVSSIAAVYSSEYLLFVVGDKNDPVSKNFLFQ
MIQVPQRGPGCQHFLTCAVCLTAPKFVGCGWCSGVCSWESDCDHHWRNDSCPPGITGFFP
RTAPPDGQTELTVFGWEFQSPLRPAITSRTHQVRLGQTACTVLPAKSNNSQLMLQQCFVL
LPSLVCKIRIGTMELFRPVNITVEVHEGKAEGRYSIDGKAEMSGFTFVCDNSRIKSLQIP
NITEIQPNYGPRIGGTLITVTGSHLDSGKTRKVTLNEVLCPIKRVTQPKGNVSSIICLSQ
HISEVRDVPLSVFIDKSPILTTKVFYYKENPTITAVLPDCSFDRGSKIVIEGENLDSVYR
TIVRFKPNESHLKPVTRECVGNSSPTKMECFTPEFPRDETEEGELSFDMDGALGLWNKEF
SYHPYGQPIPFETEGHVLSLYPGFDEVSLHHQKLNLVSSCMTIVMTMAGVNCDAKVLDNE
ITCRIPKNMSIPSEGLPVKISINGQIHNVGTVVRVSNHYMVGIVLGILAALVAGAVLAFL
VMKHLRKKKKAMMIENRLSQTATRSGANNVEMMPVGDYRRVVATLNPPTPLSGSAGFPSL
AYATGSIDPTLTPLIPPDKISISNFRPELLEEVKDVLIPAEMLVVQHHRIIGKGHFGTVY
HGYFADCNSREIHCAVKSLNNLASAFFRLFTFKWNPFYMYNSSGITDAEEVEQFLKEGII
MKGFHHCNVLSLLGILLPQEGLPLVVLPYMKHGDLRHFIRCDKRNPTVKDLIGFGLQVAT
GMEYLAQKKFVHRDLAARNCMLDESYTVKVADFGMARDVLDKEYYSVQNHRKAKLPVKWM
AIESLQTQKFTSKSDVWSFGVLIWEMLTRGASPYPDVDPYDITHYLLRGRRLPQPQFCPD
PLYRIMLQCWDPDPELRPSFATLVSAVSVILSNLEGEHYISLNVTYVNLD
Download sequence
Identical sequences H2UFL7
ENSTRUP00000035737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]