SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035738 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035738
Domain Number 1 Region: 1-431
Classification Level Classification E-value
Superfamily Sema domain 1.14e-118
Family Sema domain 0.00000122
Further Details:      
 
Domain Number 2 Region: 780-1024
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-63
Family Protein kinases, catalytic subunit 0.0000000297
Further Details:      
 
Domain Number 3 Region: 434-479
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000654
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 477-556
Classification Level Classification E-value
Superfamily E set domains 0.00000000443
Family Other IPT/TIG domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035738   Gene: ENSTRUG00000013975   Transcript: ENSTRUT00000035866
Sequence length 1066
Comment pep:known_by_projection scaffold:FUGU4:scaffold_79:818915:828213:1 gene:ENSTRUG00000013975 transcript:ENSTRUT00000035866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEKVWELRTGPVGSPECKICDLCNTDKDPSFLEDTNNEVLLLDTLFMYLYTCGSSQYGVC
YFHQLNSTGEPPSLSKCLYRKKSNSAAYCPDCVASSLGTKVTMVEEGQTVYFFVATTVND
SVTQRYGRKSLSVRRPLATEDGFYSDVRGLTVLPSLRNTYHIEYVYSFFTQEFVFFLSVQ
RESPDQESSPFQTRLGRLPRNEWEMKRYREVILECRFEPKRRRRTVGSEPYKDVVYNVVQ
AAHFGKAGRELAEELGAEEEDDILYGVFAVTDDNGVTEHDSALCAFPVDNVNKAIADGVD
DCCQSGPEQLSRGLCHFQPCESCPHESMENNATCRDQPTMVSKPYYRVDLFNRQMTDVLL
TSLLVTTIENKTVAHIGTSTGRLLQLVLTRSSPIIFANYSLVENQRVSSIAAVYSSEYLL
FVVGDKMIQVPQRGPGCQHFLTCAVCLTAPKFVGCGWCSGVCSWESDCDHHWRNDSCPPG
ITGFFPRTAPPDGQTELTVFGWEFQSPLRPAITSRTHQVRLGQTACTVLPAKSNNSHLVC
KIRIGTMELFRPVNITVEVHEGKAEGRYSIDGKAEMSGFTFVECVGNSSPTKMECFTPEF
PRDETEEGELSFDMDGALGLWNKEFSYHPYGQPIPFETEGHVLSLYPGFDEVSLHISING
QIHNVGTVVRVSNHYMVGIVLGILAALVAGAVLAFLVMKHLRKKKKVATLNPPTPLSGSA
GFPSLAYATGSIDPTLTPLIPPDKISISNFRPELLEEVKDVLIPAEMLVVQHHRIIGKGI
TDAEEVEQFLKEGIIMKGFHHCNVLSLLGILLPQEGLPLVVLPYMKHGDLRHFIRCDKRV
RRAFPTVLIQPFNPTVKDLIGFGLQVATGMEYLAQKKFVHRDLAARNCMLDESYTVKVAD
FGMARDVLDKEYYSVQNHRKAKLPVKWMAIESLQTQKFTSKSDVWSFGVLIWEMLTRGAS
PYPDVDPYDITHYLLRGRRLPQPQFCPDPLYRIMLQCWDPDPELRPSFATLVSAVSVILS
NLEGEHYISLNVTYVNLDQPRPYPALTESADEYDSTDAEDSGSASS
Download sequence
Identical sequences H2UFL8
ENSTRUP00000035738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]