SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035931 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035931
Domain Number 1 Region: 2-456
Classification Level Classification E-value
Superfamily Sema domain 3.66e-161
Family Sema domain 0.00000000149
Further Details:      
 
Domain Number 2 Region: 457-489
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000136
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 529-612
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000514
Family V set domains (antibody variable domain-like) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035931   Gene: ENSTRUG00000014047   Transcript: ENSTRUT00000036061
Sequence length 811
Comment pep:known_by_projection scaffold:FUGU4:scaffold_7:1834412:1850000:1 gene:ENSTRUG00000014047 transcript:ENSTRUT00000036061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFSVQGVFNYSMLTLSDHERVLYVGAREALFALDPNDISRQLRPQIDWPAPQDKKKECAA
KGKNNQTECFNYIRFLQTYNHTHLYTCGTYAFQPKCTLVNADYFTLSTAPLDDGKGKCPY
DPAKGHTGLIVDRELYSATLNNFLGTEPVILRNLGYQHYSMKSEYLPAWLNEPDFVGSAL
VKESSGSNDGDDDKIYFFFSERALELDCDTELTVARVARVCKGDLGGTRTLQKKWTTFQK
ARLECSLSERHVSFNNLRAVFTLPGQDWRGTTFYGIFHAQWGDVDVSAVCQYQISDVKKV
FEGSYKEYREASQRWGRYTGPVPVPRPGACITNSYRESGYNSSLQLPDATLNFAKKHPLM
EDKALARPLLLTKGVNFTKLVVDRVSALDQRAYNMLFIGTAEGWLQRVVVLGTETHVIEE
IQLFETAQPVDSLTISHSKKYVYIGSRSEVLQLPLANCSRYQSQPDCLLARDPYCAWDSE
GRACVRIDLHRGVFLSCSASCLLPGRSTSSLSQDLMLERFSRGKEHSRLRNITVVVGSDM
VLPCQLVSNLARPCWVLNDREIQLGDPDAGGARFDRTLKALVIPDAGQMQAGRYICYSEE
QGVKFQTERYQVAVVASAPIFMEARAPDSSMGLFWVLVITLGAACLLLLVVALYLRRRLK
LALGKGADMKPLESTLVYPITLPKEPPTFVPSKMPSDEDRFWETGANYYYSDGSLKIVPG
HALGPSSVSSTASPSAIPGQPIHSPSRLSLTNIRGSSSNGYIRLNLSTAGEERVSGAGGG
GGGLGNLGEELRRTLQQRSVLPDANPEESSV
Download sequence
Identical sequences H2UG61
ENSTRUP00000035931 ENSTRUP00000035931 31033.ENSTRUP00000035931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]