SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035933 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035933
Domain Number 1 Region: 2-451
Classification Level Classification E-value
Superfamily Sema domain 1.96e-160
Family Sema domain 0.0000000015
Further Details:      
 
Domain Number 2 Region: 452-485
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000837
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 504-590
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000314
Family V set domains (antibody variable domain-like) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035933   Gene: ENSTRUG00000014047   Transcript: ENSTRUT00000036063
Sequence length 774
Comment pep:known_by_projection scaffold:FUGU4:scaffold_7:1834427:1850000:1 gene:ENSTRUG00000014047 transcript:ENSTRUT00000036063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVFNYSMLTLSDHERVLYVGAREALFALDPNDISRQLRPQIDWPAPQDKKKECAAKGKNN
QTECFNYIRFLQTYNHTHLYTCGTYAFQPKCTLVNADYFTLSTAPLDDGKGKCPYDPAKG
HTGLIVDRELYSATLNNFLGTEPVILRNLGYQHYSMKSEYLPAWLNEPDFVGSALVKESS
GSNDGDDDKIYFFFSERALELDCDTELTVARVARVCKGDLGGTRTLQKKWTTFQKARLEC
SLSERHVSFNNLRAVFTLPGQDWRGTTFYGIFHAQWGDVDVSAVCQYQISDVKKVFEGSY
KEYREASQRWGRYTGPVPVPRPGACITNSYRESGYNSSLQLPDATLNFAKKHPLMEDKAL
ARPLLLTKGVNFTKLVVDRVSALDQRAYNMLFIGTAEGWLQRVVVLGTETHVIEEIQLFE
TAQPVDSLTISHSKKYVYIGSRSEVLQLPLANCSRYQSQPDCLLARDPYCAWDSEGRACV
RIDLHRGNYYMSPLFFSNPSSAEHSRLRNITVVVGSDMVLPCQLVSNLARPCWVLNDREI
QLGDPDAGGARFDRTLKALVIPDAGQMQAGRYICYSEEQGVKFQTERYQVAVVASAPIFM
EARAPDSSMGLFWVLVITLGAACLLLLVVALYLRRRLKLALGKGADMKPLESTLVYPITL
PKEPPTFVPSKMPSDEDRFWETGANYYYSDGSLKIVPGHALGPSSVSSTASPSAIPGQPI
HSPSRLSLTNIRGSSSNGYIRLNLSTAGEEREELRRTLQQRSVLPDANPEESSV
Download sequence
Identical sequences H2UG63
ENSTRUP00000035933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]