SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036212 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036212
Domain Number 1 Region: 44-537
Classification Level Classification E-value
Superfamily Sema domain 2.22e-175
Family Sema domain 0.0000000000417
Further Details:      
 
Domain Number 2 Region: 533-584
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 604-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000278
Family I set domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036212   Gene: ENSTRUG00000014155   Transcript: ENSTRUT00000036343
Sequence length 783
Comment pep:known_by_projection scaffold:FUGU4:scaffold_30:1474283:1491155:-1 gene:ENSTRUG00000014155 transcript:ENSTRUT00000036343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMKTGDFASHSRVRTLRCMSARAPLVGLMLLVALPFGAGFKQSVPRVKLDHRELLQAGSV
SLFLGPADGLHSHSLLLDEEKGRLLLGTRDHIYLLDPDDLSRTPRKIHWPAPWDRVETCK
LAGKNAKLECANFVRVLHNYNRTHVYACGTGAFHPTCAFVEITGRREDGAFRLLSSTLES
GRLKCPFDPLQPFTSMLADQYLYAGTSSDFLGKDTTFTRSLGPPPDQNYIRTDISEDYWI
NEAKFIAALPIADTYNPDDDKIYFFFREVSWEGNDKSVLSRVARVCKNDVGGLRSLTNKW
TTFLKARLVCSIPGPDGVDTHFDELQDIFLLPTRDDKNPVVYAVFTTSSSIFRGSAVCVY
SMADIRAVFNGPYAHKEGPDHRWVEYEGRIPYPRPGTCPSKTYDSKIKTTKDFPDEVLSF
IRFHPLMYHSVYPMTRRPVFTRVRVDYTLTQIVVDRVLAEDGQYEVMFLGTDAGSVLKVV
SITQENWSTEEIVLEELQVFQVPTPILSMVMSSKKQQLYVGSSEGLAQVSPSRCHLYGQA
CAECCLARDPYCAWDGQTCSRYIPASKRRARRQDIKHGDPASQCWDTEDGPMKGSVEERL
LFGVQSNSTFLECIPKSQQAKIQWNIQRPGSERKEEVQLDDRVVHTDRGLLIRSLNASDA
GVYICVAQEHTHFTRSLVRVTLQLVSNGQLDARPRSAEDLTGERRHGVESRQHYKDYLRA
MSSPFSSLEEYCDSLWLEKRPSRGRGRGLGGGKWKYIQEMKKSRNRRHHREKRGDQSKQD
GVL
Download sequence
Identical sequences H2UGZ1
ENSTRUP00000036212 ENSTRUP00000036212 31033.ENSTRUP00000036212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]