SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036416 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036416
Domain Number 1 Region: 1-281
Classification Level Classification E-value
Superfamily Sema domain 1.26e-102
Family Sema domain 0.0000000129
Further Details:      
 
Domain Number 2 Region: 277-298
Classification Level Classification E-value
Superfamily Plexin repeat 0.000034
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036416   Gene: ENSTRUG00000014242   Transcript: ENSTRUT00000036547
Sequence length 298
Comment pep:known_by_projection scaffold:FUGU4:scaffold_79:876691:884220:-1 gene:ENSTRUG00000014242 transcript:ENSTRUT00000036547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDKLYFFFREKSSEMGQSPVTQSRIGRICLNDDGGHCCLVNKWSTFLKARLICSVPEKSL
NFNSPLIGDVYIQPTQDTKNPVIYGVFSVSGSVFKGSAVCVYSMADIRMVFNGPFAHKEG
PNYQWVAYTGKIPYPRPGTCPGGTFTPNMKSTKDYPDEVINFMRNHPAMYNPVYPVHKRP
LVVRTNVDYEFTTVAVDQVAAADGNYEVLFLGTDKGTVQKVIVLPRDDLQTEELVLEEVE
VFKVPTPITTMKISSKRTKQQMYVSSMVGLTQLALHRCDMYGEACADCCLARDPYCAW
Download sequence
Identical sequences H2UHJ5
ENSTRUP00000036416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]