SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037307 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037307
Domain Number 1 Region: 24-462
Classification Level Classification E-value
Superfamily Sema domain 8.11e-106
Family Sema domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1382-1509,1697-1883
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 921-1012
Classification Level Classification E-value
Superfamily E set domains 6.3e-17
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 828-922
Classification Level Classification E-value
Superfamily E set domains 0.000000000000334
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 5 Region: 465-517
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1009-1054,1104-1141
Classification Level Classification E-value
Superfamily E set domains 0.000000726
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000037307
Domain Number - Region: 619-655
Classification Level Classification E-value
Superfamily Plexin repeat 0.0183
Family Plexin repeat 0.0093
Further Details:      
 
Domain Number - Region: 1172-1227
Classification Level Classification E-value
Superfamily E set domains 0.0367
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037307   Gene: ENSTRUG00000014605   Transcript: ENSTRUT00000037442
Sequence length 1916
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:1251979:1274142:1 gene:ENSTRUG00000014605 transcript:ENSTRUT00000037442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAQISTLFLHLIFIIFGTIYSHSYPSFSCNDTEFQHLVLHPDPSMGTVYLGARDRLFQLD
ASEGLHLKQEESTGPVSDSKDCLPPVTEVNCPQARKTSNYNKLLLVDPNALELITCGSIH
QGTCQKRSLTSIKKIIFSTERPVDTQYVAANDPMVSTVGLVVKLNCCEKTVMYVGRGYTA
SHPPISTRHLSSEPIFSYEETAKLAVTGRLSEYDHHFVMAFTRHANVYFLFYRRDIKTPL
REYRTYAARLCLNDTSYYSYVEVPLVCQSPSTSSSSYKEIDNLLGVFSSNPVSANKNPLD
SSALCIYPLDELDQHFDSTRDLCYSKGGHVRGKGEVAYIEYEVKSSCANLPLNTVKAYPC
GSDHTPSPMASRKPQEAKAVLEIFSHHLTAVAVSVRKGHSIAFLGDTKGTLHKVYLGQDG
EVKVYANITIQLNSPINKDLLLDHNGTHIYIMTKNTVQKRPVAECGAHLDCWSCLSAIDP
YCGWCVLQGRCGQHWECQQGSVQGQWIWSFNQTQQCLHIHHLSLYNISLGEKSNIIVSVK
GLPNLGKGEAYSCFFKDAQTQALFTTSGVICPTPDADSLPPIDHGDEFVVLTLSLRFMNV
IVAETEFTFYNCSLVQQLSGRRPCQGCVSSRWGCNWCIHQHVCTHKQICSKGMSHKKQKY
QRATKKEVNMKSAEECPSVERVQGSSLLPVSVERKITLLAKHLNVFQDKSLDYECVLEIE
NQSVVVDAAVEPDINQPSVFLIKCQPNQYLYSVLMEEYTAMIIVRRKNKFRIDSAEDLYV
NLFNCSVGRQDCSRCHTADPKYGCVWCNGASASGCVYQGSCNGEVQVTCPAPVIHFLDPL
SGPVEGGTVVTISGSNLGQRAEDVQNSVTVAGIPCSVINSRYEVSSKIVCVTARSGQEKI
GQALVKVQGGGLGLSAQIFSFQNPVLSSISPRRGPRAGGSSITIRGWGLRTGHSSEVSVL
IGEVPCMVLNIQEDKIICVTSGCNRTGDYRVTVHFGGAERHLLGSVYHYTPNPNITMAAP
TKSFLSGGRIIRVSGQNLDVVQEPKMRVILSPPESLPPRRKRRLSSESGRHDRGNPLKKQ
RRTVPNADCFEGTLCHLKQCLLQYESQCCVNSSTLITCPSPAVGSEARRAKVKVLFLMDS
LHFDFTSVGIDNFNYEPNPKLYPLNRNNPTKPYHHKPGSIISVEGENLDLAIYKHEVQAL
IGEGVCSVKTLTHNNLYCEPPVQQPSIDANSKQEGMDNLPEFTVKMGNLNFSLGRVKYDS
QAPSIFPVEAQVGVGVGASIVALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRDR
CKKEFTDLMTEMMDMSSDLVGSGIPFLDYRAYIERIFFPSHQESPLRRNLDVPENRRQTV
EQGLVQLSNLLNSKLFLTKFIHTLEVQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTL
LNDLVEQYVAKNPKLMLRRTESVVEKLLTNWMSVCLFTFLQESAGESFYMLFRAIKHQVD
KGPVDVVTGKAKYTLNDNRLLREDVEYRTLTLNVVIPAAATCTGATSQIVPAKVLDCDTI
TQVKEKLVEQTWKGTSFSQRPHIDSLQLEWRAGVAGHLILSDEDLTSVVQGSWKRLNTLQ
HYKVPDGATMALVLSKHHLHDSHDYMPGEKTPALDDGEEEGVRLWHLVKAREESELPKHR
KGSVRERGGERAKAIPEIYLTRLLFMKGTLQKFVDDLFTAILSTSRPVPLAVKYFFDLLD
EQALQHGITDPEIIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDAVLSVIAQTFMDS
CTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTIPASDQEMNSSLAEISRNYT
ADINCLVALHDLYKYINKYYDQIITTLEEDTTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H2UK36
ENSTRUP00000037307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]