SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037310 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037310
Domain Number 1 Region: 4-473
Classification Level Classification E-value
Superfamily Sema domain 6.8e-105
Family Sema domain 0.0000821
Further Details:      
 
Domain Number 2 Region: 1319-1446,1655-1841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.26e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 922-1013
Classification Level Classification E-value
Superfamily E set domains 5.88e-17
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 834-923
Classification Level Classification E-value
Superfamily E set domains 0.0000000000812
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 1010-1093
Classification Level Classification E-value
Superfamily E set domains 0.0000000000812
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Domain Number 6 Region: 476-528
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000037310
Domain Number - Region: 1124-1182
Classification Level Classification E-value
Superfamily E set domains 0.0166
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037310   Gene: ENSTRUG00000014605   Transcript: ENSTRUT00000037445
Sequence length 1871
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:1252048:1274130:1 gene:ENSTRUG00000014605 transcript:ENSTRUT00000037445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPSFSCNDTEFQHLVLHPDPSMGTVYLGARDRLFQLDASEGLHLKQEESTGPVSDSKDCL
PPVTEVNCPQARKTSNYNKLLLVDPNALELITCGSIHQGTCQKRSLTSIKKIIFSTERPV
DTQYVAANDPMVSTVGLVVKLNCCEKTVMYVGRGYTASHPPISTRHLSSEPIFSYEETAK
LAVTGRLSEYDHHFVMAFTRHANVYFLFYRRDIKTPLREYRTYAARLCLNDTSYYSYVEV
PLVCQSPSTSSSSYNFLQAAQVPGSPKVSSCQVGRGSGREIDNLLGVFSSNPVSANKNPL
DSSALCIYPLDELDQHFDSTRDLCYSKGGHVRGKGEVAYIEYEVKSSCANLPLNTVKAYP
CGSDHTPSPMASRKPQEAKAVLEIFSHHLTAVAVSVRKGHSIAFLGDTKGTLHKKVTISL
NFVQVYLGQDGEVKVYANITIQLNSPINKDLLLDHNGTHIYIMTKNTVQKRPVAECGAHL
DCWSCLSAIDPYCGWCVLQGRCGQHWECQQGSVQGQWIWSFNQTQQCLHIHHLSLYNISL
GEKSNIIVSVKGLPNLGKGEAYSCFFKDAQTQALFTTSGVICPTPDADSLPPIDHGDEFV
VLTLSLRFMNVIVAETEFTFYNCSLVQQLCQGCVSSRWGCNWCIHQHVCTHKQICSKGVT
IFNRNKECPSVERVQGSSLLPVSVERKITLLAKHLNVFQDKSLDYECVLEIENQSVVVDA
AVEPDINQPSVFLIKCQPNQYLYSVLMEEYTAMIIVRRKNKFRIDSAEDLYVNLFNCSVG
RQDCSRCHTADPKYGCVWCNGASASGCVYQGSCNGLHIFCTHQVTLNAILTKVVLQKLDP
LSGPVEGGTVVTISGSNLGQRAEDVQNSVTVAGIPCSVINSRYEVSSKIVCVTARSGQEK
IGQALVKVQGGGLGLSAQIFSFQNPVLSSISPRRGPRAGGSSITIRGWGLRTGHSSEVSV
LIGEVPCMVLNIQEDKIICVTSGCNRTGDYRVTVHFGGAERHLLGSVYHYTPNPNITMAA
PTKSFLSGGRIIRVSGQNLDVVQEPKMRVILSPPEYESQCCVNSSTLITCPSPAVGSEAR
RAKVKVLFLMDSLHFDFTSVGIDNFNYEPNPKLYPLNRNNPTKPYHHKPGSIISVEGENL
DLAIYKHEVQALIGEGVCSVKTLTHNNLYCEPPVQQPSIDVKMGNLNFSLGRVKYDSQAP
SIFPVEAQVGVGVGASIVALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRDRCKK
EFTDLMTEMMDMSSDLVGSGIPFLDYRAYIERIFFPSHQESPLRRNLDVPENRRQTVEQG
LVQLSNLLNSKLFLTKFIHTLEVQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLND
LVEQYVAKNPKLMLRRTESVVEKLLTNWMSVCLFTFLQESAGESFYMLFRAIKHQVDKGP
VDVVTGKAKYTLNDNRLLREDVEYRTLTLNVVIPAAATCTGATSQIVPAKVLDCDTITQV
KEKLVEQTWKGTSFSQRPHIDSLQLEWRAGVAGHLILSDEDLTSVVQGSWKRLNTLQHYK
VPDGATMALVLSKHHLHDSHDYMPGESESLNKFTYLHTLMCTSPIPSETPALDDGEEEGV
RLWHLVKAREESELPKHRKGSVRERGGERAKAIPEIYLTRLLFMKGTLQKFVDDLFTAIL
STSRPVPLAVKYFFDLLDEQALQHGITDPEIIHIWKTNSLPLRFWINILKNPQFIFDVQT
SDHVDAVLSVIAQTFMDSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTIP
ASDQEMNSSLAEISRNYTADINCLVALHDLYKYINKYYDQIITTLEEDTTAQKMQLGYRL
QQIAAAVENKV
Download sequence
Identical sequences H2UK39
ENSTRUP00000037310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]