SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037311 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037311
Domain Number 1 Region: 4-461
Classification Level Classification E-value
Superfamily Sema domain 9.94e-110
Family Sema domain 0.0000955
Further Details:      
 
Domain Number 2 Region: 1301-1428,1642-1828
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 896-987
Classification Level Classification E-value
Superfamily E set domains 5.88e-17
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 803-897
Classification Level Classification E-value
Superfamily E set domains 0.000000000000323
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 5 Region: 464-516
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 984-1068
Classification Level Classification E-value
Superfamily E set domains 0.000000035
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000037311
Domain Number - Region: 1099-1154
Classification Level Classification E-value
Superfamily E set domains 0.0245
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037311   Gene: ENSTRUG00000014605   Transcript: ENSTRUT00000037446
Sequence length 1858
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:1252048:1274130:1 gene:ENSTRUG00000014605 transcript:ENSTRUT00000037446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPSFSCNDTEFQHLVLHPDPSMGTVYLGARDRLFQLDASEGLHLKQEESTGPVSDSKDCL
PPVTEVNCPQARKTSNYNKLLLVDPNALELITCGSIHQGTCQKRSLTSIKKIIFSTERPV
DTQYVAANDPMVSTVGLVVKLNCCEKTVMYVGRGYTASHPPISTRHLSSEPIFSYEETAK
LAVTGRLSEYDHHFVMAFTRHANVYFLFYRRDIKTPLREYRTYAARLCLNDTSYYSYVEV
PLVCQSPSTSSSSYNFLQAAQVPGSLSSCQVGRGSGREIDNLLGVFSSNPVSANKNPLDS
SALCIYPLDELDQHFDSTRDLCYSKGGHVRGKGEVAYIEYEVKSSCANLPLNTVKAYPCG
SDHTPSPMASRKPQEAKAVLEIFSHHLTAVAVSVRKGHSIAFLGDTKGTLHKVYLGQDGE
VKVYANITIQLNSPINKDLLLDHNGTHIYIMTKNTVQKRPVAECGAHLDCWSCLSAIDPY
CGWCVLQGRCGQHWECQQGSVQGQWIWSFNQTQQCLHIHHLSLYNISLGIIVSVKGLPNL
GKGEAYSCFFKDAQTQALFTTSGVICPTPDADSLPPIDHGDEFVVLTLSLRFMNVIVAET
EFTFYNCSLVQQLCQGCVSSRWGCNWCIHQHVCTHKQICSKGVTIFNRNECPSVERVQGS
SLLPVSVERKITLLAKHLNVFQDKSLDYECVLEIENQSVVVDAAVEPDINQPSVFLIKCQ
PNQYLYSVLMEEYTAMIIVRRKNKFRIDSAEDLYVNLFNCSVGRQDCSRCHTADPKYGCV
WCNGASASGCVYQGSCNGEVQVTCPAPVIHFLDPLSGPVEGGTVVTISGSNLGQRAEDVQ
NSVTVAGIPCSVINSRYEVSSKIVCVTARSGQEKIGQALVKVQGGGLGLSAQIFSFQNPV
LSSISPRRGPRAGGSSITIRGWGLRTGHSSEVSVLIGEVPCMVLNIQEDKIICVTSGCNR
TGDYRVTVHFGGAERHLLGSVYHYTPNPNITMAAPTKSFLSGGRIIRVSGQNLDVVQEPK
MRGTLCHLKQYESQCCVNSSTLITCPSPAVGSEARRAKVKVLFLMDSLHFDFTSVGIDNF
NYEPNPKLYPLNRNNPTKPYHHKPGSIISVEGENLDLAIYKHEVQALIGEGVCSVKTLTH
NNLYCEPPVQQPSIDANSKQILVKMGNLNFSLGRVKYDSQAPSIFPVEAQVGVGVGASIV
ALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVG
SGIPFLDYRAYIERIFFPSHQESPLRRNLDVPENRRQTVEQGLVQLSNLLNSKLFLTKFI
HTLEVQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTE
SVVEKLLTNWMSVCLFTFLQESAGESFYMLFRAIKHQVDKGPVDVVTGKAKYTLNDNRLL
REDVEYRTLTLNVVIPAAATCTGATSQIVPAKVLDCDTITQVKEKLVEQTWKGTSFSQRP
HIDSLQLEWRAGVAGHLILSDEDLTSVVQGSWKRLNTLQHYKVPDGATMALVLSKHHLHD
SHDYMPGEMTSQNGQEMKLFHFVSCCDSLEPIPSETPALDDGEEEGVRLWHLVKAREESE
LPKHRKGSVRERGGERAKAIPEIYLTRLLFMKGTLQKFVDDLFTAILSTSRPVPLAVKYF
FDLLDEQALQHGITDPEIIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDAVLSVIAQ
TFMDSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTIPASDQEMNSSLAEI
SRNYTADINCLVALHDLYKYINKYYDQIITTLEEDTTAQKMQLGYRLQQIAAAVENKV
Download sequence
Identical sequences H2UK40
ENSTRUP00000037311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]