SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038182 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038182
Domain Number 1 Region: 26-518
Classification Level Classification E-value
Superfamily Sema domain 4.97e-189
Family Sema domain 0.0000000000000604
Further Details:      
 
Domain Number 2 Region: 514-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000392
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 581-654
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000674
Family I set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038182   Gene: ENSTRUG00000014935   Transcript: ENSTRUT00000038319
Sequence length 845
Comment pep:known_by_projection scaffold:FUGU4:scaffold_8:891144:913513:-1 gene:ENSTRUG00000014935 transcript:ENSTRUT00000038319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLFGVVVLLCGVVQAGRGAKPKHNVPRLKLSYKEMLESSNLVTFDGLANSSSYDTFLL
DEERGRLLVGAEDHLFSFDLVNINRDKKQIVWPATPSKRDECKWAGKDFWKECNNFIRVL
QPYNQTHLYICGTGAFHPICAFLEMGKRAEDNVFRLALHFENGRGKSPYDPKMLSASLLI
DGELYSGTSADFMGRDFAIFRTLGDHHPIRTEQHDSRWLNDPRFVGVHLIPESDNPEDDK
IFLFFKENAMDGEHTGKATISRIGQLCKNDMGGHRSLVNKWTTFLKARLLCSVPGVNGID
THFDELQDVFLMSSKDPKNPVIYAVFTTSSNIFKGSAVCMYNMADIRRVFLGPYAHRDGP
NYQWVPFQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARGHPAMYNPVHPIGGRPIM
VRTDVDYQFSQLVVDRVEAEDGQYDVMFIGTDVGTVLKVVMIPKESWHDLEEVVLEEMTV
FRDPTPITAMELSTKQQQLYLGSALGVSQMPLHRCEVYGKACAECCLARDPYCAWDGTEC
SRYFPTAKRRTRRQDIRNGDPLSQCSDLQHHEDADGVGSVEDRSVYGVENSSMFLECSPK
SQRALIYWQLQKPDEDRRLEIKFDERVLRTEQGLLIRSLAQSDTGVYHCQAVEHGFIQPL
LRLSLQVIPAQKLGDILPGLPATDAGVDQSAKHRLWYRDFLSLLDHPDLSSVEEFCDRVW
KKERKQKRVKTPNGNAQVRTDGGSNSALQPKAPNPQRQQAGPPQSRPWLQAGGPAAEKSE
KGTQNVGGQVPKNNQKTPKGNAAASAAAGGSRANSQHAAKWRRLQENKKGRNRRTHELQR
PPRSV
Download sequence
Identical sequences H2UML1
ENSTRUP00000038182 XP_011611649.1.43653 ENSTRUP00000038182 31033.ENSTRUP00000038182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]