SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038183 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038183
Domain Number 1 Region: 26-518
Classification Level Classification E-value
Superfamily Sema domain 3.79e-189
Family Sema domain 0.0000000000000604
Further Details:      
 
Domain Number 2 Region: 514-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000034
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 581-654
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000584
Family I set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038183   Gene: ENSTRUG00000014935   Transcript: ENSTRUT00000038320
Sequence length 766
Comment pep:known_by_projection scaffold:FUGU4:scaffold_8:891144:913513:-1 gene:ENSTRUG00000014935 transcript:ENSTRUT00000038320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLFGVVVLLCGVVQAGRGAKPKHNVPRLKLSYKEMLESSNLVTFDGLANSSSYDTFLL
DEERGRLLVGAEDHLFSFDLVNINRDKKQIVWPATPSKRDECKWAGKDFWKECNNFIRVL
QPYNQTHLYICGTGAFHPICAFLEMGKRAEDNVFRLALHFENGRGKSPYDPKMLSASLLI
DGELYSGTSADFMGRDFAIFRTLGDHHPIRTEQHDSRWLNDPRFVGVHLIPESDNPEDDK
IFLFFKENAMDGEHTGKATISRIGQLCKNDMGGHRSLVNKWTTFLKARLLCSVPGVNGID
THFDELQDVFLMSSKDPKNPVIYAVFTTSSNIFKGSAVCMYNMADIRRVFLGPYAHRDGP
NYQWVPFQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARGHPAMYNPVHPIGGRPIM
VRTDVDYQFSQLVVDRVEAEDGQYDVMFIGTDVGTVLKVVMIPKESWHDLEEVVLEEMTV
FRDPTPITAMELSTKQQQLYLGSALGVSQMPLHRCEVYGKACAECCLARDPYCAWDGTEC
SRYFPTAKRRTRRQDIRNGDPLSQCSDLQHHEDADGVGSVEDRSVYGVENSSMFLECSPK
SQRALIYWQLQKPDEDRRLEIKFDERVLRTEQGLLIRSLAQSDTGVYHCQAVEHGFIQPL
LRLSLQVIPAQKLGDILPGLPATDAGVDQSAKHRLWYRDFLSLLDHPDLSSVEEFCDRVW
KKERKQKRVKTPNGNAQHAAKWRRLQENKKGRNRRTHELQRPPRSV
Download sequence
Identical sequences H2UML2
ENSTRUP00000038183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]