SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038439 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038439
Domain Number 1 Region: 130-374
Classification Level Classification E-value
Superfamily vWA-like 2.86e-79
Family Integrin A (or I) domain 0.00000045
Further Details:      
 
Domain Number 2 Region: 375-459
Classification Level Classification E-value
Superfamily Integrin domains 2.98e-24
Family Integrin domains 0.002
Further Details:      
 
Domain Number 3 Region: 620-701
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000536
Family Integrin beta tail domain 0.0015
Further Details:      
 
Domain Number 4 Region: 25-82
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000408
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 537-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Domain Number 6 Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000038439
Domain Number - Region: 578-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038439   Gene: ENSTRUG00000015046   Transcript: ENSTRUT00000038578
Sequence length 773
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:1323253:1330145:1 gene:ENSTRUG00000015046 transcript:ENSTRUT00000038578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKINQTFWSDLCHECCNFGKRERGSCSKTVVNSCSDCIRSGPDCAWCMQENFTQPGEQET
VRCNTRALLTERGCEPQKIIAPRNKVRVVKKLPLSESFEKQEPIQLSPQVIRLKVRPGSP
ATFRVSFKRVQGYPVDLYYLMDLSNSMKDDLDNVKDLGNDLLSALKTITAHAQIGFGAFV
DKTVLPYTNTNKKKLLRPCDDDSEKCQAAFGYRHVLNLTPREQEFKQSVTNQFISGNLDS
PEGGLDAMMQAAVCGGAIGWRNSSTRLIVLTTDAGFHMAGDGKLAGILEPNDQQCHMKDN
LYYKSNEMDYPSVGQLAFQLEKNNIQTIFAVTENVQAIYKQLSAIVPKSEVGVLSNDSNN
VVELIKTAYRKLSSKITLTHDRLPDNVQITYTPECQSAGPPGPDEGVCDNVKEKQEVSFN
VTVVVDSCIKDTSFTIRILGIKDTLTVNLSTNCECNCNDPQDSQHQSCGGKGSLTCGVCS
CQEGFIGRICECAIGKEDKDTLRKACLNADGVECGGRGECVCGRCQCHGNYHGDHCECDD
EHCEKFQNQLCGGNGKCKCGVCSCNEGYEGSACQCKVSQTECKPPNGTVCHGRGVCRCSR
CECDAGYQRPHCKTCLGCPDPCQTKLNCIECLGFNIGPFKGNCSKACSTVVPNMVSQLNK
KGKQCELKDSESCWIKFSLEQLDGVDTYKAEIQSERVCPEPPSVTAIIGAAIGSVALIGI
LLLMLIKFFIYMKDVKEFRKFEKEKKKSKWTDGANPLFKNATTTTTNPIFTGE
Download sequence
Identical sequences H2UNB8
ENSTRUP00000038439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]