SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038441 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038441
Domain Number 1 Region: 131-375
Classification Level Classification E-value
Superfamily vWA-like 2.86e-79
Family Integrin A (or I) domain 0.00000045
Further Details:      
 
Domain Number 2 Region: 376-460
Classification Level Classification E-value
Superfamily Integrin domains 2.98e-24
Family Integrin domains 0.002
Further Details:      
 
Domain Number 3 Region: 621-702
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000536
Family Integrin beta tail domain 0.0015
Further Details:      
 
Domain Number 4 Region: 25-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000023
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Domain Number 6 Region: 506-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000038441
Domain Number - Region: 579-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038441   Gene: ENSTRUG00000015046   Transcript: ENSTRUT00000038580
Sequence length 774
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:1323850:1330145:1 gene:ENSTRUG00000015046 transcript:ENSTRUT00000038580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQVFFLFLLIVFLCPGLCQVGGSCSKTVVNSCSDCIRSGPDCAWCMQENFTQPGEQE
TVRCNTRALLTERGCEPQKIIAPRNKVRVVKKLPLSESFEKQEPIQLSPQVIRLKVRPGS
PATFRVSFKRVQGYPVDLYYLMDLSNSMKDDLDNVKDLGNDLLSALKTITAHAQIGFGAF
VDKTVLPYTNTNKKKLLRPCDDDSEKCQAAFGYRHVLNLTPREQEFKQSVTNQFISGNLD
SPEGGLDAMMQAAVCGGAIGWRNSSTRLIVLTTDAGFHMAGDGKLAGILEPNDQQCHMKD
NLYYKSNEMDYPSVGQLAFQLEKNNIQTIFAVTENVQAIYKQLSAIVPKSEVGVLSNDSN
NVVELIKTAYRKLSSKITLTHDRLPDNVQITYTPECQSAGPPGPDEGVCDNVKEKQEVSF
NVTVVVDSCIKDTSFTIRILGIKDTLTVNLSTNCECNCNDPQDSQHQSCGGKGSLTCGVC
SCQEGFIGRICECAIGKEDKDTLRKACLNADGVECGGRGECVCGRCQCHGNYHGDHCECD
DEHCEKFQNQLCGGNGKCKCGVCSCNEGYEGSACQCKVSQTECKPPNGTVCHGRGVCRCS
RCECDAGYQRPHCKTCLGCPDPCQTKLNCIECLGFNIGPFKGNCSKACSTVVPNMVSQLN
KKGKQCELKDSESCWIKFSLEQLDGVDTYKAEIQSERVCPEPPSVTAIIGAAIGSVALIG
ILLLMLIKFFIYMKDVKEFRKFEKEKKKSKWTDGANPLFKNATTTTTNPIFTGE
Download sequence
Identical sequences H2UNC0
ENSTRUP00000038441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]