SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038443 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038443
Domain Number 1 Region: 116-373
Classification Level Classification E-value
Superfamily vWA-like 3.81e-75
Family Integrin A (or I) domain 0.000000531
Further Details:      
 
Domain Number 2 Region: 374-472
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-19
Family Integrin domains 0.0028
Further Details:      
 
Domain Number 3 Region: 633-714
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000549
Family Integrin beta tail domain 0.0015
Further Details:      
 
Domain Number 4 Region: 3-68
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000188
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 550-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Domain Number 6 Region: 518-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000038443
Domain Number - Region: 591-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038443   Gene: ENSTRUG00000015046   Transcript: ENSTRUT00000038582
Sequence length 785
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:1324520:1330139:1 gene:ENSTRUG00000015046 transcript:ENSTRUT00000038582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGSCSKTVVNSCSDCIRSGPDCAWCMQEIWLLFEQNFTQPGEQETVRCNTRALLTERGC
EPQKIIAPRNKVRVVKKLPLSESFEKQEPIQLSPQVIRLKVRPGSPATFRVSFKRVQGYP
VDLYYLMDLSNSMKDDLDNVKDLGNDLLSALKTITAHAQIGFGAFVDKTVLPYTNTNKKK
LLRPCDDDSEKCQAAFGYRHVLNLTPREQEFKQSVTNQFISGNLDSPEGGLDAMMQAAVC
GGAIGWRNSSTRLIVLTTDAGFHMAGDGKLAGILEPNDQQCHMKDNLYYKSNEMDYPSVG
QLAFQLEKNNIQTIFAVTENVQAIYKVNIFISSFCFCFQQLSAIVPKSEVGVLSNDSNNV
VELIKTAYRKLSSKITLTHDRLPDNVQITYTPECQSAGPPGPDEGVCDNVKEKQEFLVHS
MELFFFPLQVSFNVTVVVDSCIKDTSFTIRILGIKDTLTVNLSTNCECNCNDPQDSQHQS
CGGKGSLTCGVCSCQEGFIGRICECAIGKEDKDTLRKACLNADGVECGGRGECVCGRCQC
HGNYHGDHCECDDEHCEKFQNQLCGGNGKCKCGVCSCNEGYEGSACQCKVSQTECKPPNG
TVCHGRGVCRCSRCECDAGYQRPHCKTCLGCPDPCQTKLNCIECLGFNIGPFKGNCSKAC
STVVPNMVSQLNKKGKQCELKDSESCWIKFSLEQLDGVDTYKAEIQSERVCPEPPSVTAI
IGAAIGSVALIGILLLMLIKFFIYMKDVKEFRKFEKEKKKSKWTDGANPLFKNATTTTTN
PIFTG
Download sequence
Identical sequences H2UNC2
ENSTRUP00000038443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]