SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038695 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038695
Domain Number 1 Region: 372-554
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-22
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 218-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000228
Family I set domains 0.066
Further Details:      
 
Domain Number 3 Region: 15-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000602
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 148-212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000771
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038695   Gene: ENSTRUG00000015151   Transcript: ENSTRUT00000038834
Sequence length 689
Comment pep:known_by_projection scaffold:FUGU4:scaffold_42:1255757:1315364:-1 gene:ENSTRUG00000015151 transcript:ENSTRUT00000038834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVDGCTDWSVDYLKYRVLQGEPVRLKCALFYGYIRANYSQAQSVGLSLMWYRSSGLGHSD
FEEPISFDGTRMSKEEDAIWFRPADIQDAGLYSCVLRNSTYCMKVSMSLTVAENDSNLCY
NSNMRRKEKAELSKSKEILCPDIDDYVEPGKDPDITWYKECHPKQWRASIIQKRDILSIQ
EVKEDDIGNYTCAVQFGGFVVRRTTELAVTAPLTNKPPKILFPTENKISNMELQLGNALN
LTCRAFFGYSGDVSPLIYWMKGEKFIEDLDEERFQESDIKVIKEHLGEQEVAISLTVGSI
EEEDLGNYSCYVENGNGRRHATIQLLRRAELMYTVELAGGLGAILLLLIFLISLYKCYKI
ELMLFYRRHFGSEDVDGENKDYDAYLSYTKVDPDQWSQETREEERFALEILPDVLEKHYG
YKLFIPDRDLIPTGSLANERYRDDTRLFGAYIEDVARCVDQSKRLIIVMTPNYVVRRGWS
IFELETRLRNMLATGEIKVILIECAELRGIMNYQEVEALKHTIKTLTVIKWRGAKSNKLS
SKFWKQLQYEMPFRRTEPMLTNEPALDVSEQGPFGELQTVSAISMAAATSTAMATAHPEL
RSTFHNTFHSTMRQKHYYRSYEYDLTPGGTLPPLSSLGNQHTYCNIPLTLLNGQRPPGKS
REHSLEEAHANNAMLPLLPRETSISSVIW
Download sequence
Identical sequences H2UP24
ENSTRUP00000038695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]