SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039229 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039229
Domain Number 1 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 145-189
Classification Level Classification E-value
Superfamily LCCL domain 0.000000589
Family LCCL domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039229   Gene: ENSTRUG00000015345   Transcript: ENSTRUT00000039370
Sequence length 190
Comment pep:known_by_projection scaffold:FUGU4:scaffold_42:1477027:1480672:-1 gene:ENSTRUG00000015345 transcript:ENSTRUT00000039370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REGSAFVFVLLIWTVSSYVTAEHPRDGCGPSVLGPVSGTLSSLGYPRTYPNDTVCEWEIS
VPRGSRIHFHFAELDIENRDCQVAYLRLYDGIGPKRSVIAKYCGLGLKVKELINSTGNQV
TVQFMSGTHHSGHGFYLSYSTTEYTDLITCLDKGSDFPEAEFSKYCPAGCLTSTEEISGT
IPNGYREVST
Download sequence
Identical sequences H2UQK6
ENSTRUP00000039229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]