SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040068 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040068
Domain Number 1 Region: 4-211
Classification Level Classification E-value
Superfamily Sema domain 4.05e-39
Family Sema domain 0.0009
Further Details:      
 
Domain Number 2 Region: 208-228
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000732
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040068   Gene: ENSTRUG00000015677   Transcript: ENSTRUT00000040209
Sequence length 228
Comment pep:known_by_projection scaffold:FUGU4:scaffold_91:335037:337875:-1 gene:ENSTRUG00000015677 transcript:ENSTRUT00000040209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSQMNAQLFCGDSASRHFSQLVDVATVYGQRWQDTTVYALFRNEWNMSAVCIYTIEDIER
VFRTSPFKDITWINTPVKTHFPQYCVQCASDSKQLSYEDLRSIEKGSEMLQLVHPVKNSI
PLIFKHHIYTHISVDSSQNSNGHFPVLFLSLNSGGVHKVLHNSQGFVIAEYNQITQRAYV
ISILLHPSSRKLYVNTRNELVQLDMASCSHYGDKCEDCILARDPYCGW
Download sequence
Identical sequences H2USZ5
ENSTRUP00000040068 31033.ENSTRUP00000040068 ENSTRUP00000040068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]