SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040331 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040331
Domain Number 1 Region: 29-153,185-552
Classification Level Classification E-value
Superfamily Sema domain 1.44e-169
Family Sema domain 0.000000000115
Further Details:      
 
Domain Number 2 Region: 548-599
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000122
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 614-698
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000583
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040331   Gene: ENSTRUG00000015786   Transcript: ENSTRUT00000040473
Sequence length 774
Comment pep:known_by_projection scaffold:FUGU4:scaffold_60:1381675:1388600:-1 gene:ENSTRUG00000015786 transcript:ENSTRUT00000040473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVAMTASGAQLLLLALCACRGSTLQSAPRVRLPFKELTDTKTARPFSFSFNTSDYRILL
MDQDQGRLYLGSREYLVALDMHNVNKEPLIIHWPASAKRKGECQMTGKGRQGECANFVRL
IEPWNRTHLYTCGTGAYQPICTFINRGWRAEAINWATGLFMVPPRSHVTFKRPTSVRPLP
LQDYLFRLVPGFVESGKGKCSYDPKQENIAVLLNGNLYAGVHIDFMSTDAALFRTMGGRT
AIRTEQYDSRWLNEPVFVQIQQIPDSAERNDDKLYFFFREKSLDSSGGASPSILARVGRV
CLNDEGGQKSLVNRWTTFLKARLICSVIGEDGVETRFDELRDVFIQPTQDERNPLVYAVF
TTAGSVFKGSAVCVYSMADIRNVFNGPFAHKHGHNYQWTEYTGKIPYPRPGTCPGGTFTP
GIPSSKSFSDEAVNFIRSHPLMFHPVYPTHRRPLVVRTGVDYRFTALVVDQVDAVDGRYE
VLFLGTDQGTVQKVIVLPKDPTTMEELTLEEVEVFRSKAAVKTMKISSKRQQLYVSSDAG
LTQVSLHRCSVYGRACSDCCLARDPYCAWDGESCSAFTPSTKRRSRRQDVRHGDPLRQCR
GFNAKVEKRLRETVQFGVEGSGTFLECQPRSPQASVKWLFQGEVTSVLVPQLSRAGGVLK
TDHGILLKSLNQSDAGLYHCLATENNFKHTVARVALRVLDRDIVLALTAQDDEDEEPETH
QPGPYPPPSVASTPFPPEIRLINQYCQSYWDQLSPKPQHQQRKRTSRRHTESQD
Download sequence
Identical sequences H2UTQ7
ENSTRUP00000040331 ENSTRUP00000040331 31033.ENSTRUP00000040331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]