SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040332 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040332
Domain Number 1 Region: 3-127,154-521
Classification Level Classification E-value
Superfamily Sema domain 4.71e-170
Family Sema domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 517-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000113
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 583-667
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000532
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040332   Gene: ENSTRUG00000015786   Transcript: ENSTRUT00000040474
Sequence length 732
Comment pep:known_by_projection scaffold:FUGU4:scaffold_60:1381708:1388522:-1 gene:ENSTRUG00000015786 transcript:ENSTRUT00000040474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPRVRLPFKELTDTKTARPFSFSFNTSDYRILLMDQDQGRLYLGSREYLVALDMHNVNK
EPLIIHWPASAKRKGECQMTGKGRQGECANFVRLIEPWNRTHLYTCGTGAYQPICTFINR
GWRAEGYKLGHWPRSHVTFKRPTSVRPLPLQDYLFRLVPGFVESGKGKCSYDPKQENIAV
LLNGNLYAGVHIDFMSTDAALFRTMGGRTAIRTEQYDSRWLNEPVFVQIQQIPDSAERND
DKLYFFFREKSLDSSGGASPSILARVGRVCLNDEGGQKSLVNRWTTFLKARLICSVIGED
GVETRFDELRDVFIQPTQDERNPLVYAVFTTAGSVFKGSAVCVYSMADIRNVFNGPFAHK
HGHNYQWTEYTGKIPYPRPGTCPGGTFTPGIPSSKSFSDEAVNFIRSHPLMFHPVYPTHR
RPLVVRTGVDYRFTALVVDQVDAVDGRYEVLFLGTDQGTVQKVIVLPKDPTTMEELTLEE
VEVFRSKAAVKTMKISSKRQQLYVSSDAGLTQVSLHRCSVYGRACSDCCLARDPYCAWDG
ESCSAFTPSTKRRSRRQDVRHGDPLRQCRGFNAKVEKRLRETVQFGVEGSGTFLECQPRS
PQASVKWLFQGEVTSVLVPQLSRAGGVLKTDHGILLKSLNQSDAGLYHCLATENNFKHTV
ARVALRVLDRDIVLALTAQDDEDEEPETHQPGPYPPPSVASTPFPPEIRLINQYCQSYWD
QLSPKPQHQQRK
Download sequence
Identical sequences H2UTQ8
ENSTRUP00000040332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]