SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040439 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040439
Domain Number 1 Region: 136-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-38
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily C-type lectin-like 1.04e-34
Family Link domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040439   Gene: ENSTRUG00000015828   Transcript: ENSTRUT00000040581
Sequence length 251
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:1641219:1647544:-1 gene:ENSTRUG00000015828 transcript:ENSTRUT00000040581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILALLCTLALLLQEVQAWGYRNGIFHNSIWLEQAAGVYHRESRKGRYQLTYNEAKAVC
KYEGGKLATYKQLEAARQIGFHVCAAGWFSSGRVGYPIVKAGANCGFGKVGIVDYGHRLN
KSEKWDVYCYNPDKKECGGVLTDQQRVIQSPGFPEEYQDEQICYWHIRVRLGQKIHLHFQ
DFDVEDDTACLADYLEVYDSYDDVSGFAGRFCGDGLPDDIISTGNVMTLKFLSDSSVTAG
GFKLKYTAVNS
Download sequence
Identical sequences H2UU15
ENSTRUP00000040439 ENSTRUP00000040439 31033.ENSTRUP00000040439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]