SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040475 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040475
Domain Number 1 Region: 135-383
Classification Level Classification E-value
Superfamily vWA-like 8.4e-81
Family Integrin A (or I) domain 0.0000000255
Further Details:      
 
Domain Number 2 Region: 379-470
Classification Level Classification E-value
Superfamily Integrin domains 2.93e-30
Family Integrin domains 0.0000725
Further Details:      
 
Domain Number 3 Region: 635-718
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.09e-21
Family Integrin beta tail domain 0.00016
Further Details:      
 
Domain Number 4 Region: 29-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000277
Family Plexin repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 593-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Domain Number 6 Region: 551-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000040475
Domain Number - Region: 92-158
Classification Level Classification E-value
Superfamily Integrin domains 0.000513
Family Integrin domains 0.0021
Further Details:      
 
Domain Number - Region: 475-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.062
Further Details:      
 
Domain Number - Region: 520-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family Integrin beta EGF-like domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040475   Gene: ENSTRUG00000015838   Transcript: ENSTRUT00000040617
Sequence length 801
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:1660349:1681877:-1 gene:ENSTRUG00000015838 transcript:ENSTRUT00000040617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPLPLTFHYQCLGVCYSPLCPRTTPGLNICTSGSATSCRDCLLIHPSCAWCAQEDFGRG
KTLTSRCDFIQNLQKRGCEPRFVENPSSSISVLQNIPLSSKGLSQYDVIQIMPQKLALSL
RPGGQTWFELQVRQVEDYPVDVYYLMDLSLSMKDDLETIRNLGTKLAHEMGKLTSNFRLG
FGTFVDKNMSPFSYTAEKYQENPCSGYKLFPNCVPTFGFRHILPLTDKVDRFNEEVQKQM
VSRNRDAPEGGFDAILQAAVCKEKIGWRKEAYHLLVFTTDDVPHLALDGRLGGLVEPHDG
QCHLDDNSEYSASTKMDYPSLALLGEKLAENNIFLIFAVTKQLYIIYKNFTALIPGTTVE
ILDQDSKNVIQLIVAAYNNIRSKVELSVWDHPEDISLSFTATCQDGMPLPGFRKCADLKI
GDTVSFNVSVEARSCPPHGANHSFTIKPVGFKDHLEVSVDYQCDCGCSKTAQVNSSICSS
TGTYNCGTCHCEPGYLGARCECQEGEASSIYLNACREAEGKQVCSGRGECSCNQCLCYES
EFGKIYGSFCECDDFSCARHKGILCSGHGECHCGECKCHAGYVGDNCNCSTETSSCISDD
GRMCSGRGSCACGRCQCTEPGSFGETCEKCPTCPDACATKRECIECRLFNSGQLTDNQTC
QRLCKDEIITVETLKTDDPGAVLCLYKTDNNCVMKFTYSEHTSGQSVLTTLKEPECSTGT
DALMVLLAVVGSILLVGVVLLAVWKLVITIHDWREFSRFQSARSRARYEMASNPLYKQPV
STHDLETDLSMYGKPYNGGMH
Download sequence
Identical sequences H2UU51
ENSTRUP00000040475 31033.ENSTRUP00000040475 ENSTRUP00000040475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]