SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040628 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040628
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-24
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 2 Region: 207-307
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.28e-19
Family Platelet-derived growth factor-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040628   Gene: ENSTRUG00000015892   Transcript: ENSTRUT00000040770
Sequence length 309
Comment pep:known_by_projection scaffold:FUGU4:scaffold_5:3201353:3210785:-1 gene:ENSTRUG00000015892 transcript:ENSTRUT00000040770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITVSGEGMVQSPEFPNTYPRSTEMVWRLVASANMRIQLTFDEKFGLEDPEDGICKYDFVE
VEDLAEKTILGRWCGSQLVPPGQTSKGSQIRIRFVSDEYFPSNPGFCIRYSLLPSLSPSG
ITFENREPVESKFKSVSEPELPAVLPPALQGIEELSEAVDGLGTVEEVMRYLEPERWQVD
MEELYKPSWHVLGKSFIHSKKARGGADLNLLRDEVRLYSCTPRNFSVSLREELQKTDAIF
WPSCLLVKRCGGNCACCSHRCYDCQCVPARVTKKYHEVLLLKYRNGGKGLQKTLTDVSLE
HHEECACVC
Download sequence
Identical sequences H2UUK3
31033.ENSTRUP00000040628 ENSTRUP00000040628 ENSTRUP00000040628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]