SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040798 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040798
Domain Number 1 Region: 5-106,141-507
Classification Level Classification E-value
Superfamily Sema domain 6.54e-163
Family Sema domain 0.000000000171
Further Details:      
 
Domain Number 2 Region: 503-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000141
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 573-655
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000255
Family I set domains 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040798   Gene: ENSTRUG00000015957   Transcript: ENSTRUT00000040940
Sequence length 740
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:1900186:1909282:1 gene:ENSTRUG00000015957 transcript:ENSTRUT00000040940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVADEAMDYRILHMDEDQDRMYVGCKDHVLSMDINNITHGTLKLFWPASTAKIDECQMAG
KDPTHGCGNFIRVVQPYNRTHLFMCGSGAYSPVCVYINRGRRPETALTLRLQSSGQKLNS
RRAVQEVSTFDQIQTGEKQEQVFLIDSKTESGKGRCSFNPRVNTVSVMLNQELFSGMYID
FMGTDAAIFRSLTRRNAVRTDQHNSKWLSEPIFIDAHLIPDGSDPNDSKLYFFFRERLTD
NSGNTKNIHTMVARVCPNDIGGQRSLVNKWTTFLKARMVCSVLEEDGTETHFDELESMFL
LETDHPKGLLVFGVFTSTSSVFKGSAVCVYNMADILTVFNGPFAHRDGPNFQWVAFQGRI
PYPRPGTCPGGAFTPDIQTTKEFPDEVVTFVRNHPVMFNPIYPVGRRPLVVRTNADYRYT
SVAVDQVTAADGNYQVLFLGTDKGTVQKVIVLPSNDSLHEDLILEELEVFKNQAPVTSLR
ISSKKQQLYISSEFGLSQVSLHRCQAYGSACADCCLARDPYCAWDGLSCSRFYPTGKRSF
YRRSRRQDIMHGNPLTQCRGFNLKAYRNAAEMTQYGVKNNTTFLECFPKSPQASVRWLIQ
RDNDRRKEVKLTDRVLSTEHGLLIRSAQLSDQGLYYCLTTENNFKRTVAKIRLRVLSEAM
VSMLTDKRQSQWAWAGSLRPKDLLVAFSPAESLAVQQFCKQRQQQQPAQPPGPLRGDLAK
LKPLLDRRKSRNRRNHVPEV
Download sequence
Identical sequences H2UV23
ENSTRUP00000040798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]