SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040799 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040799
Domain Number 1 Region: 1-464
Classification Level Classification E-value
Superfamily Sema domain 3.01e-167
Family Sema domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 460-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000492
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 530-612
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000239
Family I set domains 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040799   Gene: ENSTRUG00000015957   Transcript: ENSTRUT00000040941
Sequence length 702
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:1900210:1909267:1 gene:ENSTRUG00000015957 transcript:ENSTRUT00000040941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRILHMDEDQDRMYVGCKDHVLSMDINNITHGTLKLFWPASTAKIDECQMAGKDPTHGCG
NFIRVVQPYNRTHLFMCGSGAYSPVCVYINRGRRPEEQVFLIDSKTESGKGRCSFNPRVN
TVSVMLNQELFSGMYIDFMGTDAAIFRSLTRRNAVRTDQHNSKWLSEPIFIDAHLIPDGS
DPNDSKLYFFFRERLTDNSGNTKNIHTMVARVCPNDIGGQRSLVNKWTTFLKARMVCSVL
EEDGTETHFDELESMFLLETDHPKGLLVFGVFTSTSSVFKGSAVCVYNMADILTVFNGPF
AHRDGPNFQWVAFQGRIPYPRPGTCPGGAFTPDIQTTKEFPDEVVTFVRNHPVMFNPIYP
VGRRPLVVRTNADYRYTSVAVDQVTAADGNYQVLFLGTDKGTVQKVIVLPSNDSLHEDLI
LEELEVFKNQAPVTSLRISSKKQQLYISSEFGLSQVSLHRCQAYGSACADCCLARDPYCA
WDGLSCSRFYPTGKRRSRRQDIMHGNPLTQCRGFNLKDLRPSAGNAAEMTQYGVKNNTTF
LECFPKSPQASVRWLIQRDNDRRKEVKLTDRVLSTEHGLLIRSAQLSDQGLYYCLTTENN
FKRTVAKIRLRVLSEAMVSMLTDKRQSQWAWAGSLRPKDLLVAFSPAESLAVQQFCKERK
ELKNLQQRQQQQPAQPPGPLRGDLAKLKPLLDRRKSRNRRNH
Download sequence
Identical sequences H2UV24
ENSTRUP00000040799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]