SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041080 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041080
Domain Number 1 Region: 28-499
Classification Level Classification E-value
Superfamily Sema domain 8.37e-127
Family Sema domain 0.0000626
Further Details:      
 
Domain Number 2 Region: 1351-1477,1673-1862
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 950-1032
Classification Level Classification E-value
Superfamily E set domains 9.6e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 
Domain Number 4 Region: 1032-1136
Classification Level Classification E-value
Superfamily E set domains 5.88e-16
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 5 Region: 847-943
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 6 Region: 502-553
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000523
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000041080
Domain Number - Region: 799-834
Classification Level Classification E-value
Superfamily Plexin repeat 0.00017
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 1152-1207
Classification Level Classification E-value
Superfamily E set domains 0.000182
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041080   Gene: ENSTRUG00000016066   Transcript: ENSTRUT00000041223
Sequence length 1892
Comment pep:known_by_projection scaffold:FUGU4:scaffold_8:1397224:1524603:1 gene:ENSTRUG00000016066 transcript:ENSTRUT00000041223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FATTCIFPLIVFPTLPVCRGDSEEEYASFRAENSEWKFNHLAVDYRNGNVYLGAVNRIYK
LSPNLEVQVSHETGPDEDNRECYPPRIVQPCSEPLTLTNNVNKMLLMDYRENRLLACGSL
YQGICKLLRLDDLFKLGEPFHKKEHYLSGANESGPVFGVIVSYGNASPDMLFVATAVDGK
PEYFPTISSRKLARNSEEDGMFAYVFHDEFVASMIKIPSDTFTVIPDFDIYYIYGFASGN
FVYFLTLQPEMGSGPTTGSSSTGREQVYTSKIVRLCKSDPAFNSYVEVPIGCISGNVEYR
LLEAAYLSKAGSILARSLDVAPDDDVLFAVFSKGQKRHLHQSMEDSALCVFSLREINEKI
KERLQSCYKGEGTLDLAWLKVKDIPCSSALLTIDDDFCGLDMNAPLGVSEMVRGKPLYTD
AFDKMTSVIAYVYKNHSLVFVGTKSGQLKKIRVDGSSLALQYETVQAVDNGPILRDMAFS
SDFHYLYVMSETQLSRVPVEACGQYSTCSECLGSGDPHCGWCVLHNTCTRKEKCERSLEP
RRFASDIRQCVRLSVHPNNISVSQFSVTLVLEAHNVPELSAGVNCTFEDLAEMKGLVEGN
RIRCSSPAEKEMPRIIVDKGDHQIVQLYLKSKETGLVFANTSFVFYNCSVHKSCLSCVSS
PYQCHWCKYRHDCTHDPRTCSFQEGRVKKPEGCPQLLPADRILVPVNVVKPITLRAKNLP
QPQSGQRGYECLLTIQGNEHRVPALRFNSSSVQCQNTSYFYDGMDMSSLPVELTVIWNGD
FTIDNPTHNKVHLYKCDAQRGSCGLCLKADPLFGCVWCKGENRCTLKQHCPYPENQWLEH
NGINSKCTHPRITKITPLRGPREGGTLVTIRGENLGLDFREIQGNVKVAEVDCTPIREGY
IPAEQIVCEMGKAEKSQYTGNVQVCVGVGECRPEFMAKSSKYYYFVIPRIINLKPSRGPV
SGGTIVNITGSHLDAGSNVSVMFKDQPCTYLRRGGQWLTCRTHASLHGYGNVSVSVSIDR
AHLQKDLRFEYVEDPTITKIEPEWSIYSGHTPVTVTGTNLDIIQTPLIRAKYNNHETLNL
CQVLSPTSMLCQAPELPISLARQQEVLEKPDEFGFKLDDVQSLMALNNSNFIYYPNPEFE
LLSVSGVLELKPGSPIILKGRNFLPPISSGNGKLNYTVLIGEKPCMLTVSETQLLCESPN
LTGRHKVLHHKARVGGIEFSPGVVDIMSDSPLSSTAIISIAAAGAMLILVIVVVLIAYKR
KSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTM
RVLFPGIEEHPVLRDLEVPGYRQEQVEKGLKLFGQLINNKVYLLCFIRTLEAQRSFSMRD
RGNVASLIMTVLQSKLEYATDVLKHLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWF
TFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDYKTLVV
NCIHPENEKSPEIQVKVLNCDTISQVKEKILDAIYKNVPHSHRLKASDMDLEWRQGRGQR
MILQDEDITTKIEADWKRLNMLSHYQVPDNAVMALVPKQVTAYNSVNNSTVSRTSASKYE
NMIKYSGSPDSLRSRTPMITPDLESGVKVWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLL
ATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHNIHDPHVRHTWKSNC
LPLRFWVNVIKNPQFVFDIYKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAK
DIPSYKSWVERYYSDINKMPAISDQDMNAYLAEQSRMHMNEFNSMSSLSEIYSYVGKYTE
EIVCMLEHDDGARKQRLAIKLEQVVALMTLES
Download sequence
Identical sequences H2UVV2
ENSTRUP00000041080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]