SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041083 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041083
Domain Number 1 Region: 2-470
Classification Level Classification E-value
Superfamily Sema domain 1.83e-123
Family Sema domain 0.0000656
Further Details:      
 
Domain Number 2 Region: 1323-1449,1654-1843
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-51
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 921-1003
Classification Level Classification E-value
Superfamily E set domains 9.4e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 
Domain Number 4 Region: 1003-1107
Classification Level Classification E-value
Superfamily E set domains 5.88e-16
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 5 Region: 818-914
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 6 Region: 473-524
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000523
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000041083
Domain Number - Region: 770-805
Classification Level Classification E-value
Superfamily Plexin repeat 0.00017
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 1123-1178
Classification Level Classification E-value
Superfamily E set domains 0.000182
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041083   Gene: ENSTRUG00000016066   Transcript: ENSTRUT00000041226
Sequence length 1873
Comment pep:known_by_projection scaffold:FUGU4:scaffold_8:1398103:1524603:1 gene:ENSTRUG00000016066 transcript:ENSTRUT00000041226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEWKFNHLAVDYRNGNVYLGAVNRIYKLSPNLEVQVSHETGPDEDNRECYPPRIVQPCSE
PLTLTNNVNKMLLMDYRENRLLACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGANES
GPVFGVIVSYGNASPDMLFVATAVDGKPEYFPTISSRKLARNSEEDGMFAYVFHDEFVAS
MIKIPSDTFTVIPDFDIYYIYGFASGNFVYFLTLQPEMGSGPTTGSSSTGREQVYTSKIV
RLCKSDPAFNSYVEVPIGCISGNVEYRLLEAAYLSKAGSILARSLDVAPDDDVLFAVFSK
GQKRHLHQSMEDSALCVFSLREINEKIKERLQSCYKGEGTLDLAWLKVKDIPCSSALLTI
DDDFCGLDMNAPLGVSEMVRGKPLYTDAFDKMTSVIAYVYKNHSLVFVGTKSGQLKKLLN
DIRVDGSSLALQYETVQAVDNGPILRDMAFSSDFHYLYVMSETQLSRVPVEACGQYSTCS
ECLGSGDPHCGWCVLHNTCTRKEKCERSLEPRRFASDIRQCVRLSVHPNNISVSQFSVTL
VLEAHNVPELSAGVNCTFEDLAEMKGLVEGNRIRCSSPAEKEMPRIIVDKGDHQIVQLYL
KSKETGLVFANTSFVFYNCSVHKSCLSCVSSPYQCHWCKYRHDCTHDPRTCSFQEGRVKK
PEGCPQLLPADRILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGNEHRVPALRFNS
SSVQCQNTSYFYDGMDMSSLPVELTVIWNGDFTIDNPTHNKVHLYKCDAQRGSCGLCLKA
DPLFGCVWCKGENRCTLKQHCPYPENQWLEHNGINSKCTHPRITKITPLRGPREGGTLVT
IRGENLGLDFREIQGNVKVAEVDCTPIREGYIPAEQIVCEMGKAEKSQYTGNVQVCVGVG
ECRPEFMAKSSKYYYFVIPRIINLKPSRGPVSGGTIVNITGSHLDAGSNVSVMFKDQPCT
YLRRGGQWLTCRTHASLHGYGNVSVSVSIDRAHLQKDLRFEYVEDPTITKIEPEWSIYSG
HTPVTVTGTNLDIIQTPLIRAKYNNHETLNLCQVLSPTSMLCQAPELPISLARQQEVLEK
PDEFGFKLDDVQSLMALNNSNFIYYPNPEFELLSVSGVLELKPGSPIILKGRNFLPPISS
GNGKLNYTVLIGEKPCMLTVSETQLLCESPNLTGRHKVLHHKARVGGIEFSPGVVDIMSD
SPLSSTAIISIAAAGAMLILVIVVVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKE
AFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVVPGYRQEQVEK
GLKLFGQLINNKVYLLCFIRTLEAQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLS
DLIDRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQME
KGPIDSITGEARYSLSEDKLIRQQIDYKTLFTICAEDLQVVNCIHPENEKSPEIQVKVLN
CDTISQVKEKILDAIYKNVPHSHRLKASDMDLEWRQGRGQRMILQDEDITTKIEADWKRL
NMLSHYQVPDNAVMALVPKQVTAYNSVNNSTVSRTSASKYENMIKYSGSPDSLRSRTPMI
TPDLESGVKVWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFS
TAHRGSALPLAIKYMFDFLDEQADKHNIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDI
YKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDINKM
PAISDQDMNAYLAEQSRMHMNEFNSMSSLSEIYSYVGKYTEEIVCMLEHDDGARKQRLAI
KLEQVVALMTLES
Download sequence
Identical sequences H2UVV5
ENSTRUP00000041083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]