SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042189 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042189
Domain Number 1 Region: 217-327
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.55e-31
Family Pentapeptide repeats 0.001
Further Details:      
 
Domain Number 2 Region: 88-189
Classification Level Classification E-value
Superfamily POZ domain 2.75e-27
Family Tetramerization domain of potassium channels 0.0095
Further Details:      
 
Domain Number 3 Region: 2-75
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000536
Family Doublecortin (DC) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042189   Gene: ENSTRUG00000016510   Transcript: ENSTRUT00000042333
Sequence length 338
Comment pep:known_by_projection scaffold:FUGU4:scaffold_7:2709507:2711668:-1 gene:ENSTRUG00000016510 transcript:ENSTRUT00000042333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFINGTSKNGKVVAVYGTLPDLLSVASNKLGIKASCLYNAKGGLIDDIALIRDDD
VLYVSEGDPFIDPQTDRDTAHQHGSHTDWLTLNIGGRPFTTTRSTLVSKEPDSMLANMFR
ETDVWGNKRDERGAYLIDRSPEYFEPILNYLRHGQLIINEGINLRGVLEEARFFGMERLA
EQLESAIKNSQPPEDHSPISRKELVRFLLATPTKSELRCQGANLQGVKMLCTNAEGASLR
GCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLE
NCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences H2UZ10
ENSTRUP00000042189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]