SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042253 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTRUP00000042253
Domain Number - Region: 242-280
Classification Level Classification E-value
Superfamily Plexin repeat 0.00136
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042253   Gene: ENSTRUG00000016528   Transcript: ENSTRUT00000042397
Sequence length 438
Comment pep:known_by_projection scaffold:FUGU4:scaffold_15:1953627:1956119:1 gene:ENSTRUG00000016528 transcript:ENSTRUT00000042397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRARISRAVPGRGLTIKTLPDNMTRIVEDSGKYYTWRSFGPEDPRAKELWVDMTDLRRAH
VRVHGILSNSYKQAVSVPLSFDFPFYGHYLRQVTIATGGFIFTGDITHHMLTTTQYIAPL
MANFDPGYSKDSTVQYLDDGEVFVVQWEQVRLSGKESEGAFTFQAALYKTGTITFGYREM
PLSLDVISSAEHSVKVGLSDAFVLMTSEIPETQQMTIYEYHRVELDTTKITSYSAVEFRT
LPACLQHHSCDRCLSSNQTSGCSWCHVLQRCSDGMDRHRQEWLDFDCSDQDDHVAPGCTK
CSRFFSIVHGQSQNETCEDYVDISSTVTQGMESTTPLDDTKNQIFKTSDGGLRLCNSTIG
EFGGTGVIAGVAAASVLLLALVLVALYLNHHSTSASPFYLIQRRKNHWPSWRFQKQQPGY
SEVEEGHQKDSIVETGTR
Download sequence
Identical sequences H2UZ74
ENSTRUP00000042253 31033.ENSTRUP00000042253 ENSTRUP00000042253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]