SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042278 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042278
Domain Number 1 Region: 190-264
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-19
Family SH3-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000537
Family LASP-1 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042278
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00033
Family LIM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042278   Gene: ENSTRUG00000016537   Transcript: ENSTRUT00000042422
Sequence length 266
Comment pep:known_by_projection scaffold:FUGU4:scaffold_15:1957153:1970180:1 gene:ENSTRUG00000016537 transcript:ENSTRUT00000042422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPKCSRCDRIVYPTERLNCLDKCWHRGCFSCEVCKMTLNMKNYKGFEKRPYCNAHYPKT
HFTAVADTPENLRLKKQSQIQSQIYYKEDFEKNKGKATQVVDTPEFLRLKKSQQQISDIK
YHEDMSKRMVDDTPPPGIHNQGRLFQHCFIVSPHNQTYQYDPAPAPVPQPYEPAPAPVPQ
AGAPPPSSTGVRMCRPTFDQLSHPSSRRPQKRCRAMYDYTAADDDEVSFLDGDVIVDVHL
IDEGWMFGRVERTGQQGMLPANYVNN
Download sequence
Identical sequences H2UZ99
ENSTRUP00000042278 ENSTRUP00000042278 31033.ENSTRUP00000042278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]