SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042444 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042444
Domain Number 1 Region: 27-457
Classification Level Classification E-value
Superfamily Sema domain 7.19e-101
Family Sema domain 0.00088
Further Details:      
 
Domain Number 2 Region: 1375-1505,1681-1836
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-44
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 830-925
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000318
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 460-507
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 923-1017
Classification Level Classification E-value
Superfamily E set domains 0.000000000504
Family Other IPT/TIG domains 0.045
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042444
Domain Number - Region: 1017-1053
Classification Level Classification E-value
Superfamily E set domains 0.00102
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number - Region: 1528-1623
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00918
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042444   Gene: ENSTRUG00000016597   Transcript: ENSTRUT00000042588
Sequence length 1899
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:2962879:2989742:1 gene:ENSTRUG00000016597 transcript:ENSTRUT00000042588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWVSLLLLLFCKSVSQAEEENNNIPLQEFTSDTLINNVVQDPQTGRIYLGAVDSIFQL
GPSLRLQARTETGPREDARACTPPASACQDTKLMPNVNKLLLVHRSNGSLIVCGSRYRGI
CSLLNLTNVDQQLYYSDNKGERTYVASIEDNVNVVGVMSNFSKDGKTFSVFLVGKGYGSL
DSMKLISTRILQDYRDWVVFESIIETSTVQTIPFVPKFLHDFRLAFKEDGFVYFLFSRTL
DGTDSKNLTFVSRLCEEDQHYYSHTELQLSCGKNNRYNKVQAGYVASPVVASSEEDERDS
ALCMYSLRSINQRLVDIISACYSDSGKISGEPAVDMPYFFKNLYLQKDTLKNYKCGADFL
PSPLASKPQFALKANALLTRPGLLTAVAVAVENDHTVAFLGNDQGVVVKVHMTAEPYIYS
ETAGVSVGEKVNRNLFFDLSHSHIYITTEKKITKVPVQTCLQKRDCQSCVAMADPYCGWC
VLEGRCTRRSECRRAEEKNAWLWSPRKECVKIVSFYPPNLSRKKSKKVKINIPSLPAIGN
SDRLHCTVASYRSKGKMSDSGQVSCELPHPSLIPPTPYGQDFVAVEIKLFVNESVELATR
EFSFYSCAATVRKSENTPCMACVASSWGCQWNTEDHTCSDMDHVQDVNDRAWAIPFVWMH
LQGSKCPKFENPDPVLIPVGYKTRISFEGMNLERYQPCSFPALISSAETLPDRVKKKLFT
GDVDGSINSASSLASVSASAFNHHYPSIESALLISCDAFVGRKESHNLNNSSVISFTLYN
CSVGRQDCSLCKNAPMTQRCVWCAKQKACVYEKLCNPEQQGGDDPYNTECPNPQITDIIP
RFGPMGGGISITILGSNLGIHSDDIKSISVVGEPCTHRAEKYSVSTSIVCEIRPINPMSQ
LWGQVEVEVKGGKRGTSSLYFTYRNPIPEAVTPPRGLKAGGTLITISGQFLDTGSKEDVQ
VTIGGVACTVQRESFGVEITCRTGGYKGEKVPSDPFAVMVKYGKSTTTEISSAFQFVENP
IVLDHNPKKSFVCGGRTIAVTGSGFDFIQTAVMKDWLCKESAFGVLALRLQKIMQPHSSS
QPFSVPSSRPWLPRDMRDLGGVAHEKNDTVIQFRSPTVNSSLNQHLQTYILLDNWVTELR
HFEYCPDPIFNDLAKNVITEASLYRLKPVVQRSLQCVNLSHDGQRGSSVCGDVPCQVNTL
QDDKLFLDPPSTPPRARSRRQRRDTRPELLDLMIKFGKGEWVVGSVQYEKKNDLSLYIII
PAVVVPMLLIIVISIYCYSAYLYRRKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLM
IEMEDHTNDLSEGRIPFLDYKTYTDRVFFLTSKDGANDVMITGRLEIPQARRATVMQALN
QFSNLLNSKTFLINFIRTLERSNDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLELM
EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDSAGEPLYKLFRAIKHQIEKGPV
DARVKKAKYTLNDTGLLGDDVEYSVLTLQVLVQDEGPDVTSVKVLNCDTISQVKEKIIEQ
VYRNLPYSQRPKVDSVTLEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDNATLV
LSRALQTQQNYDQNQENHEERNALLEDDKVFHLVRPADELDEIKSKRGSIKDKSMTKAIT
EIYLTRLLSVKGTLQQFVDDFFRSVLCTGAVVPPAVKYFFDFLDEQALKHSVDDETIHIW
KTNSLPLRFWVNILKNPNFIFDIHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSPSNKL
LYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEVSRSHTDKLKTQVALHQLYQYAS
KYYDGIIASLDEDPAAQSKQLTLRLQQIAAALENKVTDL
Download sequence
Identical sequences H2UZR5
ENSTRUP00000042444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]