SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042445 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042445
Domain Number 1 Region: 3-463
Classification Level Classification E-value
Superfamily Sema domain 1.44e-106
Family Sema domain 0.00036
Further Details:      
 
Domain Number 2 Region: 1555-1685,1865-2020
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-43
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 1006-1101
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000315
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 466-513
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000366
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 1099-1193
Classification Level Classification E-value
Superfamily E set domains 0.000000000574
Family Other IPT/TIG domains 0.045
Further Details:      
 
Domain Number 6 Region: 1193-1239
Classification Level Classification E-value
Superfamily E set domains 0.0000933
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042445
Domain Number - Region: 1708-1807
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0194
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042445   Gene: ENSTRUG00000016597   Transcript: ENSTRUT00000042589
Sequence length 2083
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:2962954:2989742:1 gene:ENSTRUG00000016597 transcript:ENSTRUT00000042589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPLQEFTSDTLINNVVQDPQTGRIYLGAVDSIFQLGPSLRLQARTETGPREDARACTPPA
SACQDTKLMPNVNKLLLVHRSNGSLIVCGSRYRGICSLLNLTNVDQQLYYSDNKGERTYV
ASIEDNVNVVGVMSNFSKDGKTFSVFLVGKGYGSLDSMKLISTRILQDYRDWVVFESIIE
TSTVQTIPFVPKFLHDFRLAFKEDGFVYFLFSRTLDGTDSKNLTFVSRLCEEDQHYYSHT
ELQLSCGKNNRYNKVQAGYVASPGKELVRAMSESGSLGMPESKFLFVVASSEEDERDSAL
CMYSLRSINQRLVDIISACYSDSGKISGEPAVDMPYFFKTEFCTSNIALYLQKDTLKNYK
CGADFLPSPLASKPQFALKANALLTRPGLLTAVAVAVENDHTVAFLGNDQGVVVKVHMTA
EPYIYSETAGVSVGEKVNRNLFFDLSHSHIYITTEKKITKVPVQTCLQKRDCQSCVAMAD
PYCGWCVLEGRCTRRSECRRAEEKNAWLWSPRKECVKIVSFYPPNLSRKKSKKVKINIPS
LPAIGNSDRLHCTVASYRSKGKMSDSGQVSCELPHPSLIPPTPYGQDFVAVEIKLFVNES
VELATREFSFYSCAATVRKSENTPCMACVASSWGCQWNTEDHTCSDMDETAGPNIIKHRQ
KLIKTLIPVSAGTISRGKCWSEEDINSQRYRPPSTRHVQDVNDRAWAIPFVWMHLQGSKC
PKFENPDPVLIPVGYKTRISFEGMNLERYQFHRSIMSMVPSPHREFCDWEIQTAPSPQPC
SFPALISSAETLPDRVKKKKRSFFFPPSWHTGAAAHTLCRLIIHFGLIPQFSYDKSQKTN
VLFYMKDKESGKKMDSTLNGKLFHILIWRTVFFFYANALCAHFGPKAEPSLNRRQLLLIL
SSVRFKKNKKIKIAALNTTQHKRVPYSSAVMPLWVGNPMQNAVVSPLPPSAVTLYNCSVG
RQDCSLCKNAPMTQRCVWCAKQKACVYEKLCNPEQQGGDDPYNTECPNPQITDIIPRFGP
MGGGISITILGSNLGIHSDDIKSISVVGEPCTHRAEKYSVSTSIVCEIRPINPMSQLWGQ
VEVEVKGGKRGTSSLYFTYRNPIPEAVTPPRGLKAGGTLITISGQFLDTGSKEDVQVTIG
GVACTVQRESFGVEITCRTGGYKGEKVPSDPFAVMVKYGKSTTTEISSAFQFVENPIVLD
HNPKKSFVCGGRTIAVTGSGFDFIQTAVMKVNGSNMTVVEDWLCKESAFGVLASVEQQRF
CSWLNLMPALRLQKIMQPHSSSQPFSVPSSRPWLPRDMPWLQLRLLFFLKKFLLYSASSR
AAYSWLRDPKTCFLRVDLQASLYRLKPVVQRSMSLQCVNLSHDGQRGSSVCGDVPCQVNT
LQDDKLFLDPPSTPPRARSRRQRRDTRPELLDLMIKFGKGEWVVGSVQYEKKNDLSLYII
IPAVVVPMLLIIVISIYCYRYLYRRKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLM
IEMEDHTNDLSEGRIPFLDYKTYTDRVFFLTSKDGANDVMITGRLEIPQARRATVMQALN
QFSNLLNSKTFLINFIRTLERSNDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLELM
EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDSAGEPLYKLFRAIKHQIEKGPV
DARVKKAKYTLNDTGLLGDDVEYSVLTLQVLVQDEGPDVTSVKVLNCDTISQVKEKIIEQ
VYRNLPYSQRPKVDSVTLALNAEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDN
ATLVLSRALQTQQNYDQNQENHEERNALLEDDKVFHLVRPADELDEIKSKRGSIKDKSMT
KAITEIYLTRLLSVKGTLQQFVDDFFRSVLCTGAVVPPAVKYFFDFLDEQALKHSVDDET
IHIWKTNSLPLRFWVNILKNPNFIFDIHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSP
SNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEVSRSHTDKLKTQVALHQLY
QYASKYYDGIIASLDEDPAAQSKQLTLRLQQIAAALENKVTDL
Download sequence
Identical sequences H2UZR6
ENSTRUP00000042445 31033.ENSTRUP00000042445 ENSTRUP00000042445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]