SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042448 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042448
Domain Number 1 Region: 1-453
Classification Level Classification E-value
Superfamily Sema domain 2.62e-106
Family Sema domain 0.00038
Further Details:      
 
Domain Number 2 Region: 1516-1646,1826-1981
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-44
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 989-1084
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000315
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 456-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000366
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 1082-1176
Classification Level Classification E-value
Superfamily E set domains 0.00000000056
Family Other IPT/TIG domains 0.045
Further Details:      
 
Domain Number 6 Region: 1176-1221
Classification Level Classification E-value
Superfamily E set domains 0.0000826
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042448
Domain Number - Region: 1669-1768
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0187
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042448   Gene: ENSTRUG00000016597   Transcript: ENSTRUT00000042592
Sequence length 2044
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:2962969:2989742:1 gene:ENSTRUG00000016597 transcript:ENSTRUT00000042592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTSDTLINNVVQDPQTGRIYLGAVDSIFQLGPSLRLQARTETGPREDARACTPPASACQD
TKLMPNVNKLLLVHRSNGSLIVCGSRYRGICSLLNLTNVDQQLYYSDNKGERTYVASIED
NVNVVGVMSNFSKDGKTFSVFLVGKGYGSLDSMKLISTRILQDYRDWVVFESIIETSTVQ
TIPFVPKFLHDFRLAFKEDGFVYFLFSRTLDGTDSKNLTFVSRLCEEDQHYYSHTELQLS
CGKNNRYNKVQAGYVASPGKELVRAMSESGSLGMPESKFLFVVASSEEDERDSALCMYSL
RSINQRLVDIISACYSDSGKISGEPAVDMPYFFKTEFCTSNIADTLKNYKCGADFLPSPL
ASKPQFALKANALLTRPGLLTAVAVAVENDHTVAFLGNDQGVVVKVHMTAEPYIYSETAG
VSVGEKVNRNLFFDLSHSHIYITTEKKITKVPVQTCLQKRDCQSCVAMADPYCGWCVLEG
RCTRRSECRRAEEKNAWLWSPRKECVKIVSFYPPNLSRKKSKKVKINIPSLPAIGNSDRL
HCTVASYRSKGKMSDSGQVSCELPHPSLIPPTPYGQDFVAVEIKLFVNESVELATREFSF
YSCAATVRKSENTPCMACVASSWGCQWNTEDHTCSDMDETAGPNIIKHRQKLIKTLIPVS
AGTISRGKCWSEEDINSQVQDVNDRAWAIPFVWMHLQGSKCPKFENPDPVLIPVGYKTRI
SFEGMNLERYQFHRSIMSMVPSPHREFCDWEIQTAPSPQPCSFPALISSAETLPDRVKKK
KRSFFFPPSWHTGAAAHTLCRLIIHFGLIPQFSYDKSQKTNVLFYMKDKESGKKMDSTLN
GKLFHILIWRTVFFFYANALCAHFGPKAEPSLNRTTNNKHSRLQSLLSCAHLVAADLSGF
CRSFFFNSLQEMLMAPLKISPMQNAVVSPLPPSAVTLYNCSVGRQDCSLCKNAPMTQRCV
WCAKQKACVYEKLCNPEQQGGDDPYNTECPNPQITDIIPRFGPMGGGISITILGSNLGIH
SDDIKSISVVGEPCTHRAEKYSVSTSIVCEIRPINPMSQLWGQVEVEVKGGKRGTSSLYF
TYRNPIPEAVTPPRGLKAGGTLITISGQFLDTGSKEDVQVTIGGVACTVQRESFGVEITC
RTGGYKGEKVPSDPFAVMVKYGKSTTTEISSAFQFVENPIVLDHNPKKSFVCGGRTIAVT
GSGFDFIQTAVMKVNGSNMTVVEALRLQKIMQPHSSSQPFSVPSSRPWLPRDMRDLGGAK
KTSGCHKAGVDKFLLYSASSRAAYSWLRDPKTCFLRVDLQASLYRLKPVVQRSMSLQCVN
LSHDGQRGSSVCGDVPCQVNTLQDDKLFLDPPSTPPRARSRRQRRDTRPELLDLMIKFGK
GEWVVGSVQYEKKNDLSLYIIIPAVVVPMLLIIVISIYCYRYLYRRKSQQAEREYEKVKH
QLENLEESVRDRCKKEFTDLMIEMEDHTNDLSEGRIPFLDYKTYTDRVFFLTSKDGANDV
MITGRLEIPQARRATVMQALNQFSNLLNSKTFLINFIRTLERSNDFNARAKVYFASLLTV
ALHGKLEYYTDIMRTLLLELMEEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDS
AGEPLYKLFRAIKHQIEKGPVDARVKKAKYTLNDTGLLGDDVEYSVLTLQVLVQDEGPDV
TSVKVLNCDTISQVKEKIIEQVYRNLPYSQRPKVDSVTLALNAEWRPGSTGQILSDLDLT
SQKEGRWKRINTLAHYNVRDNATLVLSRALQTQQNYDQNQENHEERNALLEDDKVFHLVR
PADELDEIKSKRGSIKDKSMTKAITEIYLTRLLSVKGTLQQFVDDFFRSVLCTGAVVPPA
VKYFFDFLDEQALKHSVDDETIHIWKTNSLPLRFWVNILKNPNFIFDIHVSEVVDASLSV
IAQTFMDACTKSEHKLSRDSPSNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHL
AEVSRSHTDKLKTQVALHQLYQYASKYYDGIIASLDEDPAAQSKQLTLRLQQIAAALENK
VTDL
Download sequence
Identical sequences H2UZR9
ENSTRUP00000042448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]