SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042450 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042450
Domain Number 1 Region: 1-448
Classification Level Classification E-value
Superfamily Sema domain 1.96e-104
Family Sema domain 0.00054
Further Details:      
 
Domain Number 2 Region: 1278-1408,1605-1760
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.39e-43
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 797-892
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000293
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 451-498
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000314
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 972-1064
Classification Level Classification E-value
Superfamily E set domains 0.0000000145
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 6 Region: 890-938
Classification Level Classification E-value
Superfamily E set domains 0.000000264
Family Other IPT/TIG domains 0.07
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042450
Domain Number - Region: 1431-1526
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00891
Family Ubiquitin-related 0.027
Further Details:      
 
Domain Number - Region: 752-786
Classification Level Classification E-value
Superfamily Plexin repeat 0.0994
Family Plexin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042450   Gene: ENSTRUG00000016597   Transcript: ENSTRUT00000042594
Sequence length 1818
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:2962987:2989724:1 gene:ENSTRUG00000016597 transcript:ENSTRUT00000042594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INNVVQDPQTGRIYLGAVDSIFQLGPSLRLQARTETGPREDARACTPPASACQDTKLMPN
VNKLLLVHRSNGSLIVCGSRYRGICSLLNLTNVDQQLYYSDNKGERTYVASIEDNVNVVG
VMSNFSKDGKTFSVFLVGKGYGSLDSMKLISTRILQDYRDWVVFESIIETSTVQTIPFVP
KFLHDFRLAFKEDGFVYFLFSRTLDGTDSKNLTFVSRLCEEDQHYYSHTELQLSCGKNNR
YNKVQAGYVASPGKELVRAMSESGSLGMPESKFLFVVASSEEDERDSALCMYSLRSINQR
LVDIISACYSDSGKISGEPAVDMPYFFKTEFCTSNIAKDTLKNYKCGADFLPSPLASKPQ
FALKANALLTRPGLLTAVAVAVENDHTVAFLGNDQGVVVKVHMTAEPYIYSETAGVSVGE
KVNRNLFFDLSHSHIYITTEKKITKVPVQTCLQKRDCQSCVAMADPYCGWCVLEGRCTRR
SECRRAEEKNAWLWSPRKECVKIVSFYPPNLSRKNISVQVKINIPSLPAIGNSDRLHCTV
ASYRSKGKMSDSGQVSCELPHPSLIPPTPYGQDFVAVEIKLFVNESVELATREFSFYSCA
ATVRCMACVASSWGCQWNTEDHTCSDMDETAGPNIIKHRQGSKCPKFENPDPVLIPVGYK
TRISFEGMNLERYQDNQFTFKLVVSLGALLCLIPQFSYDKSQKTNVLFYMKDKESGKKMD
STLNAEISPMQNAVVSPLPPSAVTLYNCSVGRQDCSLCKNAPMTQRCVWCAKQKACVYEK
LCNPEQQGGDDPYNTECPNPQITDIIPRFGPMGGGISITILGSNLGIHSDDIKSISVVGE
PCTHRAEKYSVSTSIVCEIRPINPMSQLWGQVEVEVKGGKRGTSSLYFTYRNPIPEAVTP
PRGLKAGGTLITISGQFLDTGSKEDVQVTIGGVACTVTGGYKGEKVPSDPFAVMVKYGKS
TTTEISSAFQFVENPIVLDHNPKKSFVCGGRTIAVTGSGFDFIQTAVMKVNGSNMTVVEV
AHEKNDTVIQFRSPTVNSSLNQHLQTYILLDNWVTELRHFEYCPDPIFNDLAKNVITEAS
IIIVTILLLANLNFSISPSTMAHDGQRGSSVCGDVPCQVNTLQDDKLFLDPPSTPPRARS
RRQRRDTRPELLDLMYEKKNDLSLYIIIPAVVVPMLLIIVISIYCYRRKSQQAEREYEKV
KHQLENLEESVRDRCKKEFTDLMIEMEDHTNDLSEGRIPFLDYKTYTDRVFFLTSKDGAN
DVMITGRLEIPQARRATVMQALNQFSNLLNSKTFLINFIRTLERSNDFNARAKVYFASLL
TVALHGKLEYYTDIMRTLLLELMEEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLK
DSAGEPLYKLFRAIKHQIEKGPVDARVKKAKYTLNDTGLLGDDVEYSVLTLQVLVQDEGP
DVTSVKVLNCDTISQVKEKIIEQVYRNLPYSQRPKVDSVTLEWRPGSTGQILSDLDLTSQ
KEGRWKRINTLAHYNVRDNATLVLSRALQTQQNYDQNQENHEERKPFYNNFILYTFICIS
EDLIGNALLEDDKVFHLVRPADELDEIKSKRGSIKDKSMTKAITEIYLTRLLSVKGTLQQ
FVDDFFRSVLCTGAVVPPAVKYFFDFLDEQALKHSVDDETIHIWKTNSLPLRFWVNILKN
PNFIFDIHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSPSNKLLYAKEISTYKKMVDDY
YKGIRQMVPVSDQDMNTHLAEVSRSHTDKLKTQVALHQLYQYASKYYDGIIASLDEDPAA
QSKQLTLRLQQIAAALEN
Download sequence
Identical sequences H2UZS1
ENSTRUP00000042450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]