SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042451 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042451
Domain Number 1 Region: 945-1075,1245-1400
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-44
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily Sema domain 1.16e-19
Family Sema domain 0.0087
Further Details:      
 
Domain Number 3 Region: 460-555
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000021
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 106-157
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000772
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 647-739
Classification Level Classification E-value
Superfamily E set domains 0.0000000112
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042451
Domain Number - Region: 553-647
Classification Level Classification E-value
Superfamily E set domains 0.000118
Family Other IPT/TIG domains 0.051
Further Details:      
 
Domain Number - Region: 1098-1193
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00966
Family Ubiquitin-related 0.027
Further Details:      
 
Domain Number - Region: 415-449
Classification Level Classification E-value
Superfamily Plexin repeat 0.0785
Family Plexin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042451   Gene: ENSTRUG00000016597   Transcript: ENSTRUT00000042595
Sequence length 1460
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:2964558:2989730:1 gene:ENSTRUG00000016597 transcript:ENSTRUT00000042595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGADFLPSPLASKPQFALKANALLTRPGLLTAVAVAVENDHTVAFLGNDQGVVVKVHMTA
EPYIYSETAGVSVGEKVNRNLFFDLSHSHIYITTEKKITKVPVQTCLQKRDCQSCVAMAD
PYCGWCVLEGRCTRRSECRRAEEKNAWLWSPSTCPLSCSNVDPLKNNTHTHTQFPFKAFC
ISVQVKINIPSLPAIGNSDRLHCTVASYRSKGKMSDSGQVSCELPHPSLIPPTPYGQDFV
AVEIKLFVNESVELATREFSFYSCAATVRKSENTPCMACVASSWGCQWNTEDHTCSDMDE
TAGPNIIKHRQGSKCPKFENPDPVLIPVGYKTRISFEGMNLERYQKRSTWINVFYLSLFF
WSVWLFRIICSPLALRVPYSSAVMPLWVEISPMQNAVVSPLPPSAVTLYNCSVGRQDCSL
CKNAPMTQRCVWCAKQKACVYEKLCNPEQQGGDDPYNTECPNPQITDIIPRFGPMGGGIS
ITILGSNLGIHSDDIKSISVVGEPCTHRAEKYSVSTSIVCEIRPINPMSQLWGQVEVEVK
GGKRGTSSLYFTYRNPIPEAVTPPRGLKAGGTLITISGQFLDTGSKEDVQRADAELCPRL
DRESFGVEITCRTGGYKGEKVPSDPFAVMVKYGKSTTTEISSAFQFVENPIVLDHNPKKS
FVCGGRTIAVTGSGFDFIQTAVMKVNGSNMTVVEVAHEKNDTVIQFRSPTVNSSLNQHLQ
TYILLDNWVTELRHFEYCPDPIFNDLAKNVITEASIIIVTEFTVINIQASLYRLKPGQHA
AGRQALSGPAFHAATRSLPSAASRHPARAAGFNGEWVVGSVQYEKKNDLSLYIIIPAVVV
PMLLIIVISIYCYRRKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLMIEMEDHTNDL
SEGRIPFLDYKTYTDRVFFLTSKDGANDVMITGRLEIPQARRATVMQALNQFSNLLNSKT
FLINFIRTLERSNDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLELMEEYVHSKNPK
LMLRRSETVVERMLCNWMSICLYQFLKDSAGEPLYKLFRAIKHQIEKGPVDARVKKAKYT
LNDTGLLGDDVEYSVLTLQVLVQDEGPDVTSVKVLNCDTISQVKEKIIEQVYRNLPYSQR
PKVDSVTLEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDNATLVLSRALQTQQN
YDQNQENHEEHDKVFHLVRPADELDEIKSKRGSIKDKSMTKAITEIYLTRLLSVKGTLQQ
FVDDFFRSVLCTGAVVPPAVKYFFDFLDEQALKHSVDDETIHIWKTNSLPLRFWVNILKN
PNFIFDIHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSPSNKLLYAKEISTYKKMVDDY
YKGIRQMVPVSDQDMNTHLAEVSRSHTDKLKTQVALHQLYQYASKYYDGIIASLDEDPAA
QSKQLTLRLQQIAAALENKV
Download sequence
Identical sequences H2UZS2
ENSTRUP00000042451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]