SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043359 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTRUP00000043359
Domain Number - Region: 139-168
Classification Level Classification E-value
Superfamily Plexin repeat 0.0279
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043359   Gene: ENSTRUG00000016932   Transcript: ENSTRUT00000043504
Sequence length 357
Comment pep:known_by_projection scaffold:FUGU4:scaffold_6:2793260:2798552:1 gene:ENSTRUG00000016932 transcript:ENSTRUT00000043504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHQALRCCKRAINWVPVLFVNLVVGWSYYAYVVELCVYTIQNHAERSKLTVSYLVVFH
AFLMMFLWSYWKTIWSTPASPSQAFSLPRMEKELYEREERAEMQQEILKKVARTLPVYTR
MPDGAIRYCKPCQLIKPDRCHHCSTCERCVLKMDHHCPWVNNCIGFSNYKFFILFLTYAS
LHCLVICATVTQYFIKFWTVSTPASLCAPFKKLPDTHAKFHILFLFFVAALFFISIVSLL
SYHLWLVGKNRTTIETFSAAVFTSGRDKSGFSLGCSRNMTEVFGDRAKYWILPVFSGQGD
GQSFVTRLVHIDPEQANSVLQHNGKSLKDLSRNHPSPLSFLRSALNQHRVDGASSWL
Download sequence
Identical sequences H2V2C8
ENSTRUP00000043359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]