SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043362 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTRUP00000043362
Domain Number - Region: 139-168
Classification Level Classification E-value
Superfamily Plexin repeat 0.0331
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043362   Gene: ENSTRUG00000016932   Transcript: ENSTRUT00000043507
Sequence length 323
Comment pep:known_by_projection scaffold:FUGU4:scaffold_6:2793260:2797921:1 gene:ENSTRUG00000016932 transcript:ENSTRUT00000043507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHQALRCCKRAINWVPVLFVNLVVGWSYYAYVVELCVYTIQNHAERSKLTVSYLVVFH
AFLMMFLWSYWKTIWSTPASPSQAFSLPRMEKELYEREERAEMQQEILKKVARTLPVYTR
MPDGAIRYCKPCQLIKPDRCHHCSTCERCVLKMDHHCPWVNNCIGFSNYKFFILFLTYAS
LHCLVICATVTQYFIKFWTKKLPDTHAKFHILFLFFVAALFFISIVSLLSYHLWLVGKNR
TTIETFSAAVFTSGRDKSGFSLGCSRNMTEVFGDRAKYWILPVFSGQGDGQSFVTRLVHI
DPEQANSVLQHNAEFRARSVLST
Download sequence
Identical sequences H2V2D1
ENSTRUP00000043362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]