SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043478 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043478
Domain Number 1 Region: 52-520
Classification Level Classification E-value
Superfamily Sema domain 3.53e-150
Family Sema domain 0.0000000851
Further Details:      
 
Domain Number 2 Region: 516-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000977
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043478   Gene: ENSTRUG00000016974   Transcript: ENSTRUT00000043623
Sequence length 975
Comment pep:known_by_projection scaffold:FUGU4:scaffold_1:3766455:3775733:-1 gene:ENSTRUG00000016974 transcript:ENSTRUT00000043623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAALLLSELLLLLTASCTLLAVSFPEDSTPLEVVDAHFSRRYPVFRGRPSGNESQHRLD
FQLMTKIQDTLFIAGRDQVYLVSLRESYRNEIIPYRKLTWRSGQSDRDMCAVKGKHRDEC
HNFIKVLVPRNDDLVFICGTNGFNPMCRYYRLDNLEFDGEEISGLARCPFDSKQTNVALF
AEGKLYSATVADFQASDSVIYRSMGDGSALRTIKYDSKWLKEPHFLHAAEYGNYVYFFYR
EIAVEQSSLGKVVYSRVARICKNDVGGSQRVLEKHWTSFMKARLNCSVPGESFFYFDVLQ
SITDIININGVPSVVGVFTTQMNSIPGSAVCAFSMADIEKVFWGRFKEQKTQDSVWTPFP
EEKLPKPRPGSCAGHGPAASFKSSIEFPDDTLQFIKSHPLMDTAVPSLGDEPWFTKTRVR
YRLTALAVDNEAGPHKNYTVVFIGAESGVVLKVLAKTPSVSLDDSLLLEEIDVFNRAKCL
SNREDDKRVLSLHVDKEAHSLYVAFSSCVIRIPLSRCERHSSCHKSCIASRDPYCGWKPH
GACERIQPGIPTEYEQDVESGNTTHLGDCHAPVTVHPNGPIHPPVLISTQSPSSGPDPDH
YGSGFVLQDDPATSNTLNSIPGGQEGVWDIQAGETNQMVHMNILITCVFAAFLMGALLAG
LIVFCYRDSVLRKPRRVHKDTESAPSCSDSTGSFVKLNGLFDSPVKLTNSKDLNTPSTDT
KTMILRDGCQPPELAALPTPESTPVLHQKGLQPIKNQWERAQGKVSGPRKESNSSAKSPQ
FLPSPAHLNSKPHQGHVALGHSHIPSAVVLPNATHELSNMDSGEHLNDSVANPKAILQEE
PGPRARQHLTLEPMEELTEIPPVVPSREASLYSPSSSLPRHSPTKHSLSTSPNGVTMGVS
VSRQHSMNRGGCMPPTPPSRIDSHSGVMGTGMHSPHPSSISRQNSYNGHCSLPRTGLKRT
PSLKPDVPPKPNGFS
Download sequence
Identical sequences H2V2P7
ENSTRUP00000043478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]