SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043862 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043862
Domain Number 1 Region: 39-521
Classification Level Classification E-value
Superfamily Sema domain 8.89e-107
Family Sema domain 0.0000000148
Further Details:      
 
Domain Number 2 Region: 1097-1356
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.000000000901
Further Details:      
 
Domain Number 3 Region: 663-751
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000106
Family Other IPT/TIG domains 0.074
Further Details:      
 
Domain Number 4 Region: 523-570
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000942
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 5 Region: 566-633
Classification Level Classification E-value
Superfamily E set domains 0.0000000242
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 6 Region: 749-840
Classification Level Classification E-value
Superfamily E set domains 0.000000117
Family E-set domains of sugar-utilizing enzymes 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043862   Gene: ENSTRUG00000017114   Transcript: ENSTRUT00000044008
Sequence length 1404
Comment pep:known scaffold:FUGU4:scaffold_2:4528072:4564802:1 gene:ENSTRUG00000017114 transcript:ENSTRUT00000044008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCSFPAAVLLLWALSASAEGHCQKSPEPNKLNLSVSYELPTFTAEFPIQNVVTLDGII
YVGATNRIYALAPSLTKLSEYRTGPLLANQTCGQKVANASSGGGRKDNLNVALVVENIYD
KGLFSCGSADNGVCRRHVLEDDVSLDEEGRQKSVDELVYCFTDLKQDKGQPRDSDVVVSP
SGSQVLNVESNMIMFFVGNSEIPGSGNVTGPTARPHTMSLRKMKTSQNGFTFFSNRSYMD
LIPPLRGSYYLRYVYSFHSGPFTYFLTVQQVSKDSQTYHTRIVRMCSSDHDIRRYVEMPL
ECISTDKRRRRSMEDVKVFNILQAATVTKVGSDVELQRQLRLEEGDDVLFAAFARGKPNS
TEATPNSAICVMSLKLINSMFKMYMQKCNTVDLYHFTGSDKKSCYNVKRFASHAGDISRK
EGKYRLQVTQFVQRLEYWQKVLTNTLVTSITVVTVHGRAVGYLGTADGRHIQVAFSRFAS
PHVNIRLDSRPVSGSVVLPGQDPSEGALLLTTGNKITKVPLIGPGCDHLTTCTSCLVSSR
VTECGWCEGRCTRANQCPPSVWTQEYCTPVVTKVFPTSGPIRGSTTVTMCGRNFGFDKTE
SFKASLVTVEVAGVPCKLSRQDYASRWTEIQCSPMFSGNFMPSGHTVKVTSGHKIATIEG
FTFVDPVVSEIFPTFGPKSGNTMLTIRGAFLDTGNKREVTVGKAACKIQSLSATMLTCKT
PPHAVPSKQPVRLTVDSVARDAPVLYTYHQDPIISSIQPSRSFVSGGCTVAAHGLFLQSG
LQPQMVLTTGQDAEVFHVSCVYGENRTSIQCTTPSLAKLALQPPVVTKVAFVLDGYMTEQ
WDLIYVEDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLTLVGNTLE
CTVPTELQTTTSKELQVEWRQADSIRHLGKVTLAQEQDYTGLIVGCMCVSLLLLLLGTLL
LWKKNKHIDDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTNLLEASPDQG
SDRPETCRAGPPIYGGNGELLSPRLVALGSGLGLGMEGELVSPLLMAPVHIDPSCLHPDL
LTEVQHVVIAREQLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEEVS
QFLKEGIIMKDFSHPNVLSLLGICLPPEGSPLMVLPYMKHGDLRNFIRDESHNPTVKDLM
GFGLQVARGMEYLASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNKSG
VKLPVKWMALESLQTHKFTSKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGRRL
LQPEFCPDALYTVMIECWHPNPERRPSFSELVEPISSIFSSFSGEHYILLNTTYVNIEKL
NPYPSLFASTHLTPSSSSLSSDPT
Download sequence
Identical sequences H2V3S8
ENSTRUP00000043862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]