SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043863 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043863
Domain Number 1 Region: 39-524
Classification Level Classification E-value
Superfamily Sema domain 6.54e-109
Family Sema domain 0.0000000107
Further Details:      
 
Domain Number 2 Region: 1085-1344
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.000000000901
Further Details:      
 
Domain Number 3 Region: 666-754
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000103
Family Other IPT/TIG domains 0.074
Further Details:      
 
Domain Number 4 Region: 526-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000916
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 5 Region: 569-636
Classification Level Classification E-value
Superfamily E set domains 0.0000000242
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 6 Region: 752-843
Classification Level Classification E-value
Superfamily E set domains 0.000000117
Family E-set domains of sugar-utilizing enzymes 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043863   Gene: ENSTRUG00000017114   Transcript: ENSTRUT00000044009
Sequence length 1386
Comment pep:known scaffold:FUGU4:scaffold_2:4528072:4564784:1 gene:ENSTRUG00000017114 transcript:ENSTRUT00000044009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCSFPAAVLLLWALSASAEGHCQKSPEPNKLNLSVSYELPTFTAEFPIQNVVTLDGII
YVGATNRIYALAPSLTKLSEYRTGPLLANQTCGQKVANASSGGGRKDNLNVALVVENIYD
KGLFSCGSADNGVCRRHVLEDDVSLDEEGRQKSVDELVYCFTDLKQDKGQPRDSDVVVSP
SGSQVLNVESNMIMFFVGNSEIPGSGNVTGPTARPHTMSLRKMKTSQNGFTFFSNRSYMD
LIPPLRGSYYLRYVYSFHSGPFTYFLTVQQVSKDSQTYHTRIVRMCSSDHDIRRYVEMPL
ECISTDKRRRRSMEDVKVFNILQAATVTKVGSDVELQRQLRLEEGDDVLFAAFARGKPNS
TEATPNSAICVMSLKLINSMFKMYMQKCNTVDLYHFTGSDKKSCYNVKVTLVQMRNGCSG
KEGKYRLQVTQFVQRLEYWQKVLTNTLVTSITVVTVHGRAVGYLGTADGRHIQVKVAFSR
FASPHVNIRLDSRPVSGSVVLPGQDPSEGALLLTTGNKITKVPLIGPGCDHLTTCTSCLV
SSRVTECGWCEGRCTRANQCPPSVWTQEYCTPVVTKVFPTSGPIRGSTTVTMCGRNFGFD
KTESFKASLVTVEVAGVPCKLSRQDYASRWTEIQCSPMFSGNFMPSGHTVKVTSGHKIAT
IEGFTFVDPVVSEIFPTFGPKSGNTMLTIRGAFLDTGNKREVTVGKAACKIQSLSATMLT
CKTPPHAVPSKQPVRLTVDSVARDAPVLYTYHQDPIISSIQPSRSFVSGGCTVAAHGLFL
QSGLQPQMVLTTGQDAEVFHVSCVYGENRTSIQCTTPSLAKLALQPPVVTKVAFVLDGYM
TEQWDLIYVEDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLTLVGN
TLECTVPTELQTTTSKELQVEWRQADSIRHLGKVTLAQEQDYTGLIVGCMCVSLLLLLLG
TLLLWKKNKHIDDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTNLLEGYN
LDNSTCICLQCQLVALGSGLGLGMEGELVSPLLMAPVHIDPSCLHPDLLTEVQHVVIARE
QLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEEVSQFLKEGIIMKDF
SHPNVLSLLGICLPPEGSPLMVLPYMKHGDLRNFIRDESHNPTVKDLMGFGLQVARGMEY
LASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNKSGVKLPVKWMALES
LQTHKFTSKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGRRLLQPEFCPDALYT
VMIECWHPNPERRPSFSELVEPISSIFSSFSGEHYILLNTTYVNIEKLNPYPSLFASTHL
TPSSSS
Download sequence
Identical sequences H2V3S9
ENSTRUP00000043863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]