SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000045600 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000045600
Domain Number 1 Region: 93-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000045600   Gene: ENSTRUG00000017789   Transcript: ENSTRUT00000045754
Sequence length 230
Comment pep:known_by_projection scaffold:FUGU4:scaffold_53:994669:999293:-1 gene:ENSTRUG00000017789 transcript:ENSTRUT00000045754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEEMSSDGSLNVTLTLRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGSSPERIVT
ITGATEAIFRAFAMIAQKFEEDISAAMSNSSVTSKPPVTLRLVFPGSQCGSLIGKGGSKI
KEIRETTGAQVQVAGDMLPDSTERAVTISGTPQAITQCVRHICSVMLESPPKGATIPYRP
KAVTVGVHAVLAPQQSAHAFAIPGQYTFAHQDDWIHLPPQVHKKWRYLMM
Download sequence
Identical sequences H2V8R1
ENSTRUP00000045600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]