SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046694 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046694
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-37
Family Glutathione peroxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046694   Gene: ENSTRUG00000018245   Transcript: ENSTRUT00000046852
Sequence length 116
Comment pep:known_by_projection scaffold:FUGU4:scaffold_25:1608214:1609082:1 gene:ENSTRUG00000018245 transcript:ENSTRUT00000046852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAKYAERGLRILAFPSNQFGNQEPGTEAQIKQFAQSYNAQFDLFSKIEVNGPDAHPLWK
WLKEQPNGSGFMGNSIKWNFTKFLIDREGQVVKRYGPLDDPSVVENDLPQYLTNSS
Download sequence
Identical sequences H2VBV2
ENSTRUP00000046694 ENSTRUP00000046694 31033.ENSTRUP00000046694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]