SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046824 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046824
Domain Number 1 Region: 36-499
Classification Level Classification E-value
Superfamily Sema domain 5.36e-154
Family Sema domain 0.000000000585
Further Details:      
 
Domain Number 2 Region: 560-637
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000887
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 502-550
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000102
Family Plexin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046824   Gene: ENSTRUG00000018300   Transcript: ENSTRUT00000046982
Sequence length 766
Comment pep:known_by_projection scaffold:FUGU4:scaffold_25:1665529:1670748:1 gene:ENSTRUG00000018300 transcript:ENSTRUT00000046982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMSLLPILSLFSGLMLHLSFSALNTHQGVPRKTIPYQNDYKVFREDGIFNYSTMLMRDDL
GVLLLGAREAIYAVDSNDISVKKAAVYWRVTEEKQRECTYKGKQAEVECRNYIRTLHKVN
ETTMYVCGTNAFSPTCDYMTFVNGQLRLEGRQEKGQGKCPFDPFQRYSSLMVGNDLYSAT
SINFLGSEPVVLRSSDLALRTEFKSSWLNEPNFVYMDVVSESVDSPAGDDDKVYLFFSEN
AMEYDFYSKVAVSRVARVCKGDMGGQRTLQRKWTSFMKARLDCSLPELSLPPIVQDVFLL
KDDDWRRSVFYAVFTSQSSLSQLSTVCAYSVTEIGDIFSEGKFKTPVAVETSHIKWVMYT
GEMPVPRPGACINNVARKMGMNRSLDLPDKTLQFIRDRPLMDEAARPLTGGPLLVKRGAV
LTRIVVDSVLALDGRRHAVMFIGTENGYVQKAVNYDGEMFVIEEIQVYENPVPINTLSLS
ASKGQVYAGSEIGAVQVPVCTCGRYHTCVDCILARDPYCGWDLAAERCVAVRGLSGSALQ
SLKEGDLSQCPDTDPIAAVDVVLVPGNNIQLPCQVHSNLAQVLWQFSNQTLHSSDKYYIY
SEGLLIGNASESDAGWYTCYSAETISTRTFTQTMAVYRLELNSGSGENQSDPGRVTRLEV
AVALLSLICFSLIGFIFWNWSQGHLTCVKRGQPPVQAEGPRQSGEYMHIPSRPSEMKLPQ
VRSERPFRANNNHSAVDFKRPEEHRLAPANVSTLNGLGYINDESEI
Download sequence
Identical sequences H2VC81
ENSTRUP00000046824 31033.ENSTRUP00000046824 ENSTRUP00000046824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]