SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000000443 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000000443
Domain Number 1 Region: 124-369
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-65
Family Nuclear receptor ligand-binding domain 0.0000000258
Further Details:      
 
Domain Number 2 Region: 55-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000000443   Gene: ENSTRUG00000000198   Transcript: ENSTRUT00000000446
Sequence length 446
Comment pep:known_by_projection scaffold:FUGU4:scaffold_157:419496:424732:-1 gene:ENSTRUG00000000198 transcript:ENSTRUT00000000446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSQSKSLLDMEVANYCEGLDPSYSTLGFENAEVFYGGGADSMPTEPSLPGPDGVTTNCAI
CGDKATGKHYGASSCDGCKGFFRRSIRKSHIYTCRFSRQCIVDKDKRNQCRFCRLNKCFR
AGMKKEAVQNERDRISSRRSIPDSQELPPITILAQAETLSKQITSPVGIVDMSEQKAATV
GDVCDSMRQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRSMSFRDFLL
LGNGCVIHRNSPEPEICRIANRVLDELVQPFQDIQIDDNEYAALKAIVFFDPDAKSLRNP
SKIKAMRLQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLCGLAK
IDNLLQEMLLGGLTSEPSHLHHPAHTQLAQDPLTGHTLVISAVSAAHTPLIEIKCKCLSV
LIRHPAASPDTPIPSPPQGPAPDKYK
Download sequence
Identical sequences H2RJY0
31033.ENSTRUP00000000443 ENSTRUP00000000443 ENSTRUP00000000443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]