SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000000773 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000000773
Domain Number 1 Region: 347-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-51
Family SPRY domain 0.0000375
Further Details:      
 
Domain Number 2 Region: 12-80
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-17
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 3 Region: 132-189
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000824
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000000773   Gene: ENSTRUG00000000338   Transcript: ENSTRUT00000000776
Sequence length 528
Comment pep:known_by_projection scaffold:FUGU4:scaffold_519:25179:28875:-1 gene:ENSTRUG00000000338 transcript:ENSTRUT00000000776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAPELFSEQELTCSICLDLFDEPVSTPCGHNFCQVCIGGYWASSAVCTCPLCKHQF
DERPQLSVNKVFALIADKYKEATASAEEVVWCDVCTGVKRPASSSCLTCTASYCPEHEQP
HRTSAFYAKHPLMDPREALKGRTCSLHRRLMEVYCRICQRCICAICVLEEHRTHKTVSVQ
TERLVKQKLVARTEQEMVNRIKDKETRVSHLKKKMEAAKNYADAERAELERLLGEVSRSL
DRIQSRVVGDIDSQLDAVMSKGEGLVGRLETELSLLTDRRATLEVQAINQDHIGFLQSYE
EATAPLEETRQNDEGDLMVAESVLSLRGSSASLRRSQWSLRDMKKSKQVTEDVTLNPVTA
YPFLILSDDRKQVKRGEKLQFFRNSQQRFDVWSCVIAKEGFSNGRHYWEVFVGDSKDWKL
GVVTEAAQRKGLFDLTPASGYYAIWWSGSHLRALTTPPLTKVKAPPKLRQVGVFLDMDEG
QVTFYNIKSGSEIYSFTRGREFTDRMFPLFGTGDKDVPLVLMTTQHHL
Download sequence
Identical sequences H2RKW0
ENSTRUP00000000773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]