SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000001578 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000001578
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.7e-36
Family PDI-like 0.0015
Further Details:      
 
Domain Number 2 Region: 334-477
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-29
Family PDI-like 0.0014
Further Details:      
 
Domain Number 3 Region: 137-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000559
Family PDI-like 0.022
Further Details:      
 
Domain Number 4 Region: 234-366
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000112
Family PDI-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000001578   Gene: ENSTRUG00000000661   Transcript: ENSTRUT00000001586
Sequence length 497
Comment pep:known_by_projection scaffold:FUGU4:scaffold_274:114417:118637:-1 gene:ENSTRUG00000000661 transcript:ENSTRUT00000001586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMAAVFRLVSTVSFLLYCFPGASSTRQDVLELGDADFDYLATEHETMLVKFYAPWCGHCK
KLAPTFQKAASRLKGTVQLAKVDCTANTETCSRFGVSGYPTLKIFRSGKDSAPYDGPRTA
DGIYEYMKRQTGPDSLHLKTDEDLQAFIDNYDASIIGVFSGADSSRLSEFLTASSLLREQ
FRFAHTTDLKLGEKSVLLFRPPRLKNMFEDGMVVFTDHLTIGSLRRFIRDHIYGLCPHMT
VENRERLRARDVLTAFYDLDYHHNIRGSSYWRNRVMKVASKYAGQGLTFSVASKKDFLSE
LEEDFGLGMSDGGELPVITIRTRTGHKYTMREEFTRDGKSLERFVDDYLAGRLKPYVKSE
PVPERNVDAVKTVVAETFDAIVNDPGKDALILFYSPSCLHCKKLEPVFRELAGKLEADPN
IVVVKMNAQDNDVPLGYQVQGFPTIYLARAGRKDEPIRYEGGRELRDFLKFLRREVGRSL
IVDGSKDELKGRAPSSL
Download sequence
Identical sequences H2RN65
ENSTRUP00000001578 ENSTRUP00000001578 31033.ENSTRUP00000001578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]