SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000001579 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000001579
Domain Number 1 Region: 14-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-36
Family PDI-like 0.0015
Further Details:      
 
Domain Number 2 Region: 331-474
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-29
Family PDI-like 0.0014
Further Details:      
 
Domain Number 3 Region: 127-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000836
Family PDI-like 0.034
Further Details:      
 
Domain Number 4 Region: 231-363
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000895
Family PDI-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000001579   Gene: ENSTRUG00000000661   Transcript: ENSTRUT00000001587
Sequence length 491
Comment pep:known_by_projection scaffold:FUGU4:scaffold_274:115116:118607:-1 gene:ENSTRUG00000000661 transcript:ENSTRUT00000001587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVSFLLYCFPGASSTRQDVLELGDADFDYLATEHETMLVKFYAPWCGHCKKLAPTFQKAA
SRLKGTVQLAKVDCTANTETCSRFGVSGYPTLKIFRSGKDSAPYDGPRTADGIYEYMKRQ
TGPDSLHLKTDEDLQAFIDNYDASIIGVFSGADSSRLSEFLTASSLLREQFRFAHTTDLK
LGEKYGVILIRSVLLFRPPRLKNMFEDGMVVFTDHLTIGSLRRFIRDHIYGLCPHMTVEN
RERLRARDVLTAFYDLDYHHNIRGSSYWRNRVMKVASKYAGQGLTFSVASKKDFLSELEE
DFGLGMSDGGELPVITIRTRTGHKYTMREEFTRDGKSLERFVDDYLAGRLKPYVKSEPVP
ERNVDAVKTVVAETFDAIVNDPGKDALILFYSPSCLHCKKLEPVFRELAGKLEADPNIVV
VKMNAQDNDVPLGYQVQGFPTIYLARAGRKDEPIRYEGGRELRDFLKFLRREVGRSLIVD
GSKDSYKKQKI
Download sequence
Identical sequences H2RN66
ENSTRUP00000001579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]